KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331523
Entry
4331523           CDS       T01015                                 
Name
(RefSeq) chitin elicitor-binding protein
  KO
K13473  chitin elicitor-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331523
SSDB
Motif
Pfam: LysM HTH_23
Other DBs
NCBI-GeneID: 4331523
NCBI-ProteinID: XP_015630176
UniProt: Q8H8C7
Structure
LinkDB
Position
3
AA seq 356 aa
MASLTAALATPAAAALLLLVLLAAPASAANFTCAVASGTTCKSAILYTSPNATTYGNLVA
RFNTTTLPDLLGANGLPDGTLSSAPVAANSTVKIPFRCRCNGDVGQSDRLPIYVVQPQDG
LDAIARNVFNAFVTYQEIAAANNIPDPNKINVSQTLWIPLPCSCDKEEGSNVMHLAYSVG
KGENTSAIAAKYGVTESTLLTRNKIDDPTKLQMGQILDVPLPVCRSSISDTSADHNLMLL
PDGTYGFTAGNCIRCSCSSTTYQLNCTAVQNKGCPSVPLCNGTLKLGETNGTGCGSTTCA
YSGYSNSSSLIIQTSLATNQTTACQRGGSGRSQFARSMWSMSVISFHMVLIIICFL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgtcgctcaccgccgccctggccacgccggcggccgctgccctcctcctcctcgtc
ctcctcgccgcccccgcctccgccgccaacttcacctgcgcggtggcttcaggcaccacc
tgcaagtccgccatcctctacacctcccccaacgccaccacctacggcaacctcgtcgcc
cgcttcaacaccaccaccctccccgacctcctcggcgccaacggcctccccgacggcacg
ctttcctccgcccccgtcgccgccaattccaccgtcaaaatccccttccgctgccgctgc
aacggcgacgtcggccagtcggaccgcctccccatctacgtcgtgcagccgcaggacggg
ctcgacgccatcgcgcgcaacgtgttcaacgccttcgtcacctaccaggagatcgccgcc
gcgaacaacatccccgaccccaacaagataaatgtcagccagacgctgtggattccgctg
ccctgcagctgcgacaaggaggaaggctctaacgtgatgcacctcgcctacagcgtcggc
aaaggggagaacacgtcggcgatcgctgccaagtacggggtgacggagtccacgcttctc
accagaaataagatcgacgaccccacgaaattgcagatgggacagattctagatgtcccg
ctccctgtgtgccgttcatcaatcagcgatacctcagctgatcacaatctgatgctcctc
ccggatggcacctatggattcaccgcaggaaactgcatccgctgcagctgcagttcaact
acctaccagctaaactgcactgcagtacagaacaagggatgcccgtcagtgccactgtgc
aatggaacgctgaagcttggtgagacgaacggcaccggttgcggatcaacaacgtgcgcc
tacagtggttactccaacagttcatcgctcatcatacaaaccagccttgcaactaatcag
acaacagcctgccagagaggaggatctgggaggtcgcagttcgctaggtccatgtggagc
atgtctgttatctccttccacatggtgttgatcattatctgtttcctttga

DBGET integrated database retrieval system