KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331611
Entry
4331611           CDS       T01015                                 
Name
(RefSeq) pheophorbide a oxygenase, chloroplastic
  KO
K13071  pheophorbide a oxygenase [EC:1.14.15.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4331611
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.17  pheophorbide a oxygenase
     4331611
SSDB
Motif
Pfam: PaO Rieske VanA_C
Other DBs
NCBI-GeneID: 4331611
NCBI-ProteinID: XP_015633218
UniProt: Q0DV66
LinkDB
Position
3:2576509..2580452
AA seq 654 aa
MRAPAAHLSPASSAVPSRNHGLLLHLRFLLSSSVSHLSARENSNPPSGCWFSCQKQAILP
VPVSSRLPPPPSCYYSVLLEEHWSPRLPQSPLTTPGASYKNRHAKNLQNHTETSDLRGFP
SESTKMPVMAPTASLLLSPRPLPASRRVPSLPALSASGRLRLRRARADTRLRVAAPPSVP
GEADQAPGETEPSTSSADEKFVWRDHWYPVSLVEDLDPSVPTPFQLLNRDLVIWKDPKSG
EWVALDDRCPHRLAPLSEGRIDETGCLQCSYHGWSFDGSGACTRIPQAAPEGPEAKAVRS
PKACAIKFPTLVSQGLLFVWPDENGWEKATATKPPMLPKEFEDPAFSTVTIQRDLYYGYD
TLMENVSDPSHIEFAHHKVTGRRDRARPLPFKMESSGAWGYSGSNSGNPRISATFVAPCY
ALNKIEIDTKLPIFGDQKWVIWICSFNIPMAPGKTRSIVCSARNFFQFSMPGKAWWQLVP
RWYEHWTSNLVYDGDMIVLQGQEKIFLSASKESSADINQQYTKITFTPTQADRFVLAFRA
WLRKFGNSQPDWFGNPSQEVLPSTVLSKREMLDRYEQHTLKCSSCKGAYNAFQTLQKVFM
GATVAFCATAGIPADVQFRLLLAAAALVSAAVAYAFYTLQKNFVFVDYVHAEID
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgcgtgctcctgctgcacacttgtcccccgcctcctccgccgtgccgtcacgcaaccac
ggactcctcctccacctccgtttcctactctcttcttcagtttctcacctctccgcacga
gaaaattcgaatcccccttccggctgctggttttcgtgccagaaacaggcgattttacca
gtgccagttagctctcgccttcctcctcctccatcgtgctactactctgttcttctggaa
gaacactggtctcctcgcctacctcagtcaccactcaccacaccaggtgcgagctataaa
aaccggcacgccaaaaatcttcaaaaccacacagaaacctcagatctccgaggcttccca
agcgagtcgacgaaaatgcccgtgatggctccgaccgcatctcttctcctctccccgagg
ccgctgccggcgagccgccgggtcccctcgctcccggcgctctcggcttccggtcgcctg
cgcctccgccgcgcccgcgccgacacacggctccgcgtggcggcgccgccgtccgtcccc
ggggaggcggaccaggcgcccggggagaccgagccgagcacgtcgtcggccgacgagaag
ttcgtgtggagggaccactggtaccccgtgtccctcgtcgaggacctcgaccccagcgtg
cccaccccgttccagctcctcaaccgcgacctcgtcatctggaaggacccaaaatccggc
gagtgggtcgccctcgacgaccgttgcccccatcgcctcgcgcccctctcggaggggcgg
atcgatgagacggggtgcttgcagtgctcataccacggctggtcattcgatggctccggc
gcgtgcacccggatcccgcaggcggcgcccgaggggccggaggccaaggctgtgaggtcg
ccgaaggcgtgcgcgatcaagttccccaccctcgtctcgcaagggctgctcttcgtgtgg
cccgacgagaatgggtgggagaaggccacggctaccaagcctccgatgttaccgaaggag
tttgaggatcctgcgttctccacggtgaccatccagagggatctgtactatggctatgat
acattgatggagaacgtctctgatccgtcgcatatagaatttgctcaccacaaggtcact
ggtcgaagagatcgagccaggcctttgccattcaagatggaatcaagtggtgcatgggga
tattcagggtcaaattctggaaaccctcgcatcagtgcaacttttgtggccccttgctat
gcactgaacaaaattgagatagacacaaagttacccatttttggagatcagaaatgggtc
atatggatttgctctttcaacattccaatggccccagggaagactcgttctatagtttgt
agtgctcggaactttttccagtttagcatgccaggaaaagcatggtggcagcttgtccct
cgatggtatgagcattggacttcaaatttggtctatgatggtgatatgatagttctgcaa
gggcaagagaagattttcttgtctgcatcgaaggagtcttctgcagatattaatcagcag
tacacaaagatcacgtttacacccacgcaggctgaccgttttgttttggcattccgggca
tggctaaggaaatttggtaacagccaacctgactggtttggaaatcctagccaagaagtg
ttgccttccactgtcctttcaaagcgtgagatgctagatagatatgagcagcacacactg
aaatgctcatcttgcaaaggggcatacaacgccttccagactctgcaaaaggtcttcatg
ggagcgacagtggcgttctgtgcaactgctgggattcctgcggatgttcagttcagatta
ttgcttgccgctgctgctttggttagtgccgctgtagcgtacgcattttatacgctccag
aagaattttgtatttgtagattacgtgcatgctgagattgattaa

DBGET integrated database retrieval system