KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331662
Entry
4331662           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S9-2
  KO
K02997  small subunit ribosomal protein S9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331662
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331662
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4331662
SSDB
Motif
Pfam: S4 Ribosomal_S4
Other DBs
NCBI-GeneID: 4331662
NCBI-ProteinID: XP_015630751
UniProt: Q0IRR9 Q2R1J8
LinkDB
Position
3:2985997..2989234
AA seq 195 aa
MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH
LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM
AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQK
KASGGGGDGEEEDEE
NT seq 588 nt   +upstreamnt  +downstreamnt
atggttcacgtcagcttctaccgcaactatggtaagacattcaagaagccacgtcgccct
tacgagaaggagcgtcttgatgcagagctgaagctagtgggtgagtatggactgaggtgc
aagcgtgagctgtggcgtgttcagtatgctttgagccgtatccgtaacaatgcaaggcat
ctgctcacacttgatgagaagaatccacgccgcatctttgagggtgaggcactgcttcgc
cgcatgaaccgttatgggctccttgctgatgggcagaacaagcttgattatgtccttgcc
ctcactgttgagaacttcctcgcaaggcgtcttcagactcttgtcttcaaggctggcatg
gccaagtccatccaccatgctcgtgtcctgatcaggcaacgccacatcagggtcggcagg
caaattgtcaacatcccgtcgttcatggtgagggttgagtctgagaagcacattgacttc
tcactgacaagcccattcggtggaggcccccctggtagggtgaagaggaagaaccagaag
aaggcaagtggcggtggcggtgacggtgaggaggaagatgaggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350869
Entry
4350869           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S9-2
  KO
K02997  small subunit ribosomal protein S9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4350869
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4350869
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4350869
SSDB
Motif
Pfam: S4 Ribosomal_S4
Other DBs
NCBI-GeneID: 4350869
NCBI-ProteinID: XP_015616973
UniProt: Q0IRR9 Q2R1J8
LinkDB
Position
11:23184389..23187562
AA seq 195 aa
MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH
LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM
AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQK
KASGGGGDGEEEDEE
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtccacgtcagcttctaccgcaactatggtaagacattcaagaagccacgtcgccct
tacgagaaggagcgtcttgatgcagagctgaagctagtgggtgagtatggactgaggtgc
aagcgtgagctgtggcgtgttcagtatgctttgagccgtatccgtaacaatgcaaggcac
ctgctcacacttgatgagaagaatccacgccgcatcttcgagggtgaggcactgcttcgc
cgcatgaaccgttatgggctccttgctgatgggcagaacaagcttgattatgtccttgcc
ctcactgttgagaacttcctcgcaaggcgtcttcagactcttgtcttcaaggctggcatg
gccaagtccatccaccatgctcgtgtcctgatcaggcaacgccacatcagggtcggcagg
caaattgtcaacatcccgtcgttcatggtgagggttgagtctgagaaacacattgacttc
tcactgacaagcccattcggtggaggcccccctggtagggtgaagaggaagaaccagaag
aaggcaagcggcggtggcggtgatggtgaggaggaagatgaggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268088
Entry
9268088           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S9-2
  KO
K02997  small subunit ribosomal protein S9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9268088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9268088
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9268088
SSDB
Motif
Pfam: S4 Ribosomal_S4
Other DBs
NCBI-GeneID: 9268088
NCBI-ProteinID: XP_015616975
UniProt: Q0IRR9 Q2R1J8
LinkDB
Position
11:23180276..23182861
AA seq 195 aa
MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH
LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM
AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQK
KASGGGGDGEEEDEE
NT seq 588 nt   +upstreamnt  +downstreamnt
atggttcacgtcagcttctaccgcaactatggtaagacattcaagaagccacgtcgccct
tacgagaaggagcgtcttgatgcagagctgaagctagtgggtgagtatggactgaggtgc
aagcgtgagctgtggcgtgttcagtatgctttgagccgtatccgtaacaatgcaaggcac
ctgctcacacttgatgagaagaatccacgccgcatcttcgagggtgaggcactgcttcgc
cgcatgaaccgttatgggctccttgctgatgggcagaacaagcttgattatgtccttgcc
ctcactgttgagaactttctcgcaaggcgtcttcagactcttgtcttcaaggctggcatg
gccaagtccatccaccatgctcgtgtcctgatcaggcaacgccacatcagggtcggcagg
caaattgtcaacatcccatcattcatggtgagggttgagtctgagaagcacattgacttc
tcactgacaagcccattcggtggaggcccccctggtagggtgaagcggaagaaccagaag
aaggcaagcggcggtggtggtgacggtgaggaagaagatgaggaatga

DBGET integrated database retrieval system