KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331677
Entry
4331677           CDS       T01015                                 
Name
(RefSeq) protein RRP6-like 2
  KO
K12591  exosome complex exonuclease RRP6 [EC:3.1.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331677
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     4331677
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     4331677
SSDB
Motif
Pfam: DNA_pol_A_exo1 HRDC
Other DBs
NCBI-GeneID: 4331677
NCBI-ProteinID: XP_015631122
UniProt: Q10RJ0 A0A8J8XN55
LinkDB
Position
3:3103786..3109800
AA seq 600 aa
MDEFKGPGEKEKEEEAGDKAAAEEAGDGFQVVRGKKKKRPNGGSASGAGSGTMMAKDKAA
AAAAAEPWTKAKVSFHDPNIPRPQDVYAIRVNNYNVPFDHVWLERTEDGSRPIHPLEKLP
MEQFIDRNVPESEPVKPADLEDTPFTLVEDKNGLADLAKKLKSVNEFAVDLEHNQYRSFQ
GLTCLMQISTRTEDFVVDTLKLRIYIGLYLKEHFKDPTKRKVMHGADRDIMWLQRDFHIY
VCNLFDTGQASRVLQMERNSLEHLLRHFCGVTANKEYQNADWRSRPLSDEMIKYAREDTH
YLLYMYDLMRLRLQKESTSDNDLLLEVQKRSNEICLQLYEKELLTDTSYLHIYGLQEHDL
DAKQLAVVYALHQWRDYIAREVDESTGYVLPNKALIEIAKKMPTDTAELKRMVKSKYPFV
DENLDQVVGIIWNATESSYAFESRAEQLKKERLEQLTDRVQTISSPEMKTSMNLSGQIRS
MDKEILSDNIHQQVAQATFQELKRPMALGAVGNSTSGGQRDFFGGFSNKSEKMEKAKSYP
AFYYPQLPQYSPEVGYGFQSINRTMAGTAQSPTGNKERDLQNPRRRQSFPPSGNISDTHQ
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggacgagttcaaaggcccaggggagaaggagaaggaggaggaggccggggacaaggcc
gcggcggaggaggcgggggacggattccaggtggtgcgcggtaagaagaagaagcggccc
aatggtggttcggcttcgggtgctgggtcggggacgatgatggccaaggacaaggcggcg
gcggcggcggccgcggagccgtggacgaaggcgaaggtgtctttccacgatcccaacatt
ccgcggccgcaggatgtgtacgcaatcagagtgaacaactacaacgtgccgttcgaccat
gtctggctagagcgcaccgaagatggcagccgccctatccaccctctggaaaaactgcca
atggagcagtttattgacagaaatgttcctgaaagtgaacctgtaaagccagctgatttg
gaggataccccatttacgctagttgaagataagaatggtttagcagacttagctaaaaag
ttgaagagtgtaaatgaatttgctgttgacttggagcacaatcaatataggtcatttcag
ggtttgacctgcttgatgcagatttcaacaagaacagaggattttgttgtagacaccctt
aaacttcgcatatacattggtctctacttgaaagaacattttaaagatccaaccaagaga
aaggtaatgcatggggctgatcgtgatattatgtggctccaacgggatttccacatatat
gtttgcaatctttttgacacaggacaggcttcaagggttttacagatggagcgaaacagc
ctagagcacctattgcgtcacttttgtggagtcacagcaaataaagaatatcaaaacgct
gattggaggtcaaggccactttctgatgaaatgataaagtatgctagagaagatacacac
tatctgttgtatatgtatgacttgatgaggttgagactgcaaaaggagtcgacatctgac
aatgatcttcttctagaggtgcaaaagcgcagtaatgaaatttgtttacagttgtatgaa
aaggaactgctgacagatacatcttatctccacatatacgggttgcaagaacatgacctg
gatgcaaaacagctggctgttgtatatgctctacatcaatggagagattatatagctcgt
gaagtagatgagagcactggttatgtgttaccaaataaggctttaattgagatagcaaag
aagatgcctacagatactgcagagttaaaaagaatggtgaaatcaaaatatccatttgtt
gatgaaaatctggaccaagtcgtaggcatcatatggaatgcaactgaatcttcttatgcc
tttgaaagcagagctgaacaactaaagaaggaacgtctggagcagctaacggacagggtt
cagactatatcatcacctgagatgaagacatctatgaacttatcaggccagattagatca
atggataaggaaatactgagcgataacatacatcagcaggtggcacaggctacttttcaa
gaactgaagagacctatggctttgggagcagtagggaattcaacatccgggggacagaga
gatttctttggagggttttcaaataagtctgagaagatggagaaggctaaatcctatcca
gccttttactacccccagcttccacaatatagccctgaagttgggtacggctttcaatca
ataaaccgaactatggcgggaacagcacagtctcctactggcaataaggagagggatctc
cagaaccctagaagacgtcaatctttcccaccttccggtaacataagtgatacacaccag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270208
Entry
9270208           CDS       T01015                                 
Name
(RefSeq) protein RRP6-like 2
  KO
K12591  exosome complex exonuclease RRP6 [EC:3.1.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9270208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9270208
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     9270208
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     9270208
SSDB
Motif
Pfam: DNA_pol_A_exo1 HRDC PMC2NT RRP7
Other DBs
NCBI-GeneID: 9270208
NCBI-ProteinID: XP_015614782
UniProt: Q7XE52
LinkDB
Position
10:complement(15637583..15644440)
AA seq 902 aa
MEEADDAPPPWRPSKPAAAIDGSSGPLAAAAARLSGRSRALPSSRDFHFYNNFPSFRSPV
GAAAARAGASLAALGAAPFYPKRHPPFPGDDLDDAQDWVVGVIDDLAEQFGASMDEFKAA
REEEEATGRRATEEDGFQVVYGKKKKKVMGGGGGEEGVGRGGEAFGGGSGSVKMATRDKS
AAPGAKAKVPFHIPTIPRPQDVHRILVDNSSKPFEHSWLEKSDDGSRVVHPLEKIPMEQL
VDRDFPESEPIKPPALDDTPFTHVEDLKSLEVLATKLKSATEFAVDLEHNHYRSFQGLTC
LMQISTRTEDFIVDTLKLRKYLGDYLREIFKDPTKKKVMHGADRDIIWLQRDFGIYVCNL
FDTGQASRILQMDRNSLEHLLHHFCGVTANKEYQSADWRLRPLPDEMIKYAREDTHYLLY
IYDLMRLRLVKESSDENDLLLEVYKRSKEICLQLYEKELLTHSSYLYIHGLKENEFDARQ
LSVLANIYKWRDSVARGEDESTGYILPNKTLLEIAKQMPATTGRLKRIVKSKNSYLERHL
GHVISTIRSAIANCDAFESIAEQLKKGRLEELAVANMKSNDGDTEMVPADDGNNDDDNVG
PSDEHGAVASVENVGAASHCTGNVTSGASSVNVQLENPAETKSLGILSGVSGQDMEVLSN
GDRKQVAKATVQVSKRPTAFGALLGKPTSGRRQNLFSGFSSGQNMVDKIKSSVALPFHNF
CGGAKSPATSIPLEESVRPEPESIQYSDPACQTEDVIQLGTETDGPQPPENHNKDGQGHL
VPDDMEMSRSPPEHSSAGAKQRFQSLIESRNQQQNHKPHQEPEFNHQLKPFDYAEARKNI
TFGERKAERIKDNAVARAINKDSGDKGRTSNQFGAGENEGNRQNPRGRQAFPPSGNRSAT
YH
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggaagaagcggacgacgccccgccgccgtggaggcccagcaagccggcggcggccatc
gacggctcgtcggggcccctcgccgccgccgccgcgcgcctctccggccgctcccgcgcg
ctcccatcctcccgcgacttccacttctacaacaacttcccctccttcaggtcccccgtc
ggcgccgccgccgccagggcgggcgcctccctcgccgccctcggcgccgcccccttctac
ccgaagcggcacccgccgttccccggggacgacctcgacgacgcccaggactgggtcgtc
ggcgtcatcgacgacctggccgagcagttcggcgcctccatggacgagttcaaggcggcg
cgggaggaggaggaggcgactggccggagggcgacggaggaggacgggttccaggttgtt
tacggcaagaagaagaagaaggtgatgggcggcggcggcggcgaggagggggttggtaga
ggtggtgaggcgtttggtggtggttctggctcggtgaagatggccaccagggataagtcg
gccgcgccgggggcgaaggcgaaggtgccattccacattcccaccatcccgcggccgcag
gacgtgcaccgcatattggtggacaactcgagcaagccattcgagcattcatggcttgag
aagagcgatgatggttcccgtgttgtccatccattggaaaagatccccatggaacaattg
gttgacagagattttcctgaaagcgagccgataaagcctcctgctttggatgatacccct
tttacacatgtcgaagacttgaaatccttggaggtgctagctacaaagctgaagagtgca
accgagtttgctgttgatttggaacacaaccactataggtcttttcagggtctgacctgc
ctgatgcagatttcaactagaactgaggactttatagtggacactcttaagcttcgcaaa
tatcttggtgattacttaagagaaatttttaaagacccaacaaagaaaaaggtaatgcat
ggtgcagatcgtgatataatatggcttcaacgggactttggcatatatgtatgcaacctt
tttgacacaggccaggcttcaagaatcttgcagatggaccgcaacagcctggagcatctt
ttgcatcatttctgtggagtgactgcaaacaaagaatatcagagcgcagattggaggttg
agaccacttcctgatgaaatgatcaagtatgctagagaagatacacattatctgctttac
atatatgatttgatgagactcagactggtgaaagagtcttcagatgaaaatgatcttctt
ttagaggtttacaagcgaagcaaagaaatttgcctgcaactatatgagaaagaactgctg
acacattcatcatatctttacatacatgggttgaaagaaaatgaatttgatgcaaggcag
ctgtcagttcttgctaatatatataaatggagagattccgttgctcgtggcgaggatgag
agcactggttatatattgccgaataagacgctgcttgagatagcaaagcagatgcctgcg
accactgggaggttaaaaagaatagtgaaatcaaaaaattcgtatcttgaacgccatctt
ggccatgttatttccactatcaggagtgccattgcaaattgtgatgcttttgaaagtata
gctgagcagttaaagaagggacgtctggaagagttggcagtggcaaacatgaagagcaac
gatggagacactgaaatggttcctgctgatgatggtaataacgatgatgataatgttggc
ccgagtgatgaacatggtgctgttgccagtgttgaaaatgttggcgctgcttctcattgt
actgggaatgttacaagtggagcttcttcagttaatgtacagctagaaaaccctgcagaa
actaagagcttaggaatcttgtcgggtgtttctggacaagatatggaggtactgagcaat
ggtgataggaagcaagtagcaaaagccacagttcaagtgtcaaagagacctacagctttt
ggagctctattagggaaaccaacttctggaagaagacaaaaccttttttcagggttttca
agcgggcagaatatggtggacaagataaaatcttcagtggcacttcctttccataatttc
tgtggcggtgcaaaatctccggccactagcattccattggaagaatcagtgcgtcctgaa
ccagaaagcatccagtatagtgatccagcttgtcagacggaagatgttatacagttgggc
actgaaacagatggtccccaacccccagaaaatcacaataaagatggacaaggccacctt
gtacctgatgacatggagatgtctaggtcccctcctgagcattcttctgctggtgccaag
caacgcttccagtcactcatcgaaagtagaaaccaacaacagaaccacaagccacaccaa
gaaccagaatttaaccaccagctgaagccttttgattacgctgaagccagaaagaacata
acatttggagagcgtaaagccgagagaatcaaagacaatgcagtggccagggcaataaac
aaggattctggagataaaggtagaacctcaaaccaattcggtgctggagagaacgagggg
aatcgccagaatcctcgggggcgacaggcattcccgccttctggcaacagaagtgctaca
taccattag

DBGET integrated database retrieval system