KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331740
Entry
4331740           CDS       T01015                                 
Name
(RefSeq) carbon catabolite repressor protein 4 homolog 1
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331740
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     4331740
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4331740
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4331740
SSDB
Motif
Pfam: Exo_endo_phos zf-C6H2 zf-MYND
Other DBs
NCBI-GeneID: 4331740
NCBI-ProteinID: XP_015632782
UniProt: Q10R99 A3AEH4
LinkDB
Position
3:3616579..3622207
AA seq 607 aa
MLTILRVHLPSEIPIVGCEITPYVLLRRPDGGISTEDVHEAIPLDGHFMRYKWYRIQSDR
RVAVCNVHPTEQATIQCLGCLKSKIPVAKSYHCSAKCFSDAWQHHRVLHERALSALNENG
NEEEELFGRFGSGNAGIINASLSGSTSNIGQSSSVNNGPTPVYPTGTEKNSGETWFEVGR
SRTYTPTADDIGHALRFECVAVDSETRSSVGAPTSIMTSRVIPAPTPTPRRLIPVNSADV
MGHFDLDSRNSSFGTFTVLSYNILADTYATSDTYSYCPTWALSWPYRRQNLLREIIGYHA
DIICLQEVQSNHFEEFFAPELDKHGYQALFKKRTTEVYTGNLQSIDGCATFFRRDKFSHV
KKYEVEFNKAAQSLTDAIIPAAQRKVALTRLIKDNIALIAVLEAKFGSHGADNPSKRQLL
CVANTHINVHQDLKDVKLWQVNTLLKGLEKIAVSADIPMLVCGDFNATPGSTPHGLLAMG
KVDLMHPDLAIDPLGILRPASKLTHQLPLVSAYSSFARMVGAGYDLEHQRRRMDPATNEP
LFTNCTRDFTGTIDYIFYTADSLSVESLLELLDEDSLRKDTALPSPEWSSDHIALLAEFR
CKPRVRR
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgctgaccatcctgcgggtgcacctcccgtcggagatccctatcgtgggctgcgagatc
acgccctacgtgctcctgcggcgccccgatggcggcatctccaccgaagatgtgcatgag
gccatccctctggatgggcactttatgcggtataaatggtaccgcatacaaagtgatcga
agagtcgctgtctgcaatgttcatccaacagaacaggcaacaatacagtgcttggggtgt
ttgaagtcaaaaataccagttgctaagagctaccattgttctgctaagtgcttctcagat
gcctggcaacaccacagggtgttgcatgaacgtgctttgagcgctttaaatgaaaatggc
aacgaagaggaggagttatttggccgatttggtagtggcaatgcagggattataaatgcc
agtttatctggctcaacatcaaatattggacagagctcaagtgttaataatggacctaca
cctgtgtatcccactggaactgaaaagaattctggtgaaacttggtttgaagtgggacgt
tcacggacgtatacgccaactgctgatgatattgggcatgccctaagattcgaatgtgta
gcagtggattcagaaacaaggtcgagtgtgggagctccaacttcaatcatgacatctcgt
gtaattcctgctccaacacccactccgcgtcgtctgataccagtgaattcggctgatgta
atgggacactttgatctagacagccgaaattcttcttttgggacattcacagtgttgtct
tacaatattcttgctgatacatatgcaacaagtgatacatacagctattgcccaacttgg
gcactttcatggccttacagaagacaaaatttgctgcgtgaaataattggttaccatgcg
gatatcatctgccttcaggaggtacaaagtaaccactttgaagaattctttgcaccggag
cttgacaaacatggatatcaggcactgttcaagaaaaggacaactgaggtgtacactggc
aatctccaatcaattgatggatgtgctactttctttcgaagggacaaattttcacatgtc
aaaaaatacgaggttgagtttaataaggctgcacagtctttaactgatgcaattattcca
gctgctcaaagaaaagtggctttaactcgattgattaaggataacattgcgttgattgca
gttttagaagctaagtttggtagccatggggctgataaccctagcaaaagacagctcctt
tgtgtggcaaatacgcatatcaatgttcaccaagacctcaaagatgtcaagctatggcag
gttaacaccctcctaaaaggtttagaaaaaatagctgtcagtgcggacattccaatgctg
gtctgtggagatttcaatgcaacccctggaagtactccacatgggcttcttgcaatgggg
aaagttgatctgatgcatccagatctagcaatagatcctcttggaattttgcgaccagca
agcaagttgacacaccagcttcctctggtgagtgcgtactcttcatttgcaaggatggtt
ggtgctggttatgatttggagcaccagaggaggagaatggaccctgcaacaaatgaacca
cttttcacaaattgcacgagggatttcactgggaccattgattacatattttacacagcg
gattcgttatcagtggaatcgttgctggaacttctggatgaggatagcttacggaaagac
actgcgcttccttcacctgaatggtcatcagatcatatagcactcttagcagaatttcgg
tgcaagcctagagttagacgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338672
Entry
4338672           CDS       T01015                                 
Name
(RefSeq) carbon catabolite repressor protein 4 homolog 4
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4338672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4338672
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     4338672
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4338672
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4338672
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 4338672
NCBI-ProteinID: XP_015640179
UniProt: B9FPE1 Q6I5Y3
LinkDB
Position
5:complement(18845941..18849966)
AA seq 389 aa
MLKLQASLPLFRLRPRPSSPPPCGPRLPFVPICKRRMSTQAQPSFAPLPTAQSESDAGAA
GYQFRLVSYNILAQVYVKSAFFPHSPSACLKWKTRSKAVLSELKSFEADLMCIQELDEYD
TFYKKNMENSGYSSIYIQRSGDKRDGCGIFYKPKSMELVQKEVLHYNDLVEKYVHTDHVN
SDTSNNSSPTEEASKKVDNNKHGDPNDPRFRLKRDCVGLLAAFKLNDPCDHILIMANTHI
YWDPEWIDVKLAQAKYILSRVTQFEKLISNKFNCKPSVMIAGDFNSTPGDKVYNYLVSAN
SDSTDEAPIKLRSLYAANGGEPEFTNCTPGFTGTLDYIFLSDGSSVKPTSLLRIPRGDSA
EVQGGLPNFHHPSDHLPIGADFQVLGSEG
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctaaagctccaagcttccctccctctcttccgcctccgtccccgccccagctcccct
cctccctgcggcccccgtctccccttcgtcccaatttgcaagcggcggatgagcacccag
gcgcagcccagtttcgcccctctccccacggcgcaatccgaatccgatgcaggggcagct
gggtaccagttccggctggtttcctacaacatcttggcccaggtttatgtgaagagtgcg
tttttcccgcattctccatctgcctgtctcaagtggaaaactcggtctaaagctgttcta
tcagaactcaagagcttcgaagctgacctcatgtgcatacaggagttggatgagtatgat
accttctacaagaaaaacatggagaattctggatattcaagtatttacattcaacgatct
ggggacaaacgggatggatgtggcatattctataaaccaaaaagcatggaactggtccag
aaggaagtactacattacaatgatttagtggaaaaatatgttcatactgatcatgtaaat
agtgatacatcaaataattcttcaccaacagaagaagcaagcaagaaggtggataataac
aagcatggagatccaaatgatccacgtttcagattgaaacgtgactgtgttggtttactt
gccgctttcaagcttaatgatccttgtgatcatattttaattatggcgaacacacatatt
tattgggatcctgaatggattgatgtaaaattggctcaagcaaagtatattctttcaaga
gttactcagtttgagaaacttatctcgaataaatttaactgtaaaccttcagtcatgatt
gctggtgacttcaactcaactcctggtgacaaggtatacaactacctcgtatcagccaac
tccgattctacggacgaagctccgatcaaattacgcagcctttatgctgcgaatggaggg
gagccagagttcaccaactgcactcctggttttacaggaacactggactacatattcttg
tcggacggcagttcagtaaaacctaccagtctacttcgtataccacgaggggattctgcc
gaagtccaaggagggctacccaactttcaccatcctagcgatcatttgccaatcggtgcc
gattttcaggtactcggcagcgaaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348610
Entry
4348610           CDS       T01015                                 
Name
(RefSeq) carbon catabolite repressor protein 4 homolog 1
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4348610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348610
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     4348610
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4348610
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4348610
SSDB
Motif
Pfam: Exo_endo_phos zf-C6H2 zf-MYND
Other DBs
NCBI-GeneID: 4348610
NCBI-ProteinID: XP_015614670
UniProt: Q338D5 Q0IXR4
LinkDB
Position
10:complement(14357053..14362439)
AA seq 605 aa
MLSVVRVHLPSEIPIVGCEITPYVLLRLPTGVVSTDDVPEAAPADGYFMRYRWYRIQSDR
KVAICSVHPMEQATIQCLGCVKSKIPVAKSYHCSAKCFSDAWQHHRVLHERASSALNENG
AEEEELFGRFGSTGSGVLSTTGSGSMSNLGQSPGLNNGPVPLYPSGTDKNSGETWYEVGR
TRTYTPTADDIGHVLRFECVSVDAEKKVPVGPPTSIMTSRVIPAPTPTPRRLIQVNGDVL
SHLDLDSQTSFGTFSVLSYNILADAYATSDAYSYCPTWALSWTYRRQNLMREIIGYHADI
ICLQEVQLNHFEDFFSPELDKHGYQALYKKRTTEVYTGAPHAIDGCATFFRRDKFSHVKK
YEVEFNKAAQSLTDAIIPSTQRRVALSRLIKDNVALIAVLEAKFGNHGTDNPGKRQLLCV
ANTHVNVHQDLKDVKLWEVQTLLKGLEKIAVSADIPMLVCGDFNSVPGSSPHGLLAMGKV
DQLHPDLAIDPLGILRPASKLTHQLPLVSAYSSFARMVGVGYDLEHQRRRMDPATNEPLF
TNCTRDFTGTVDYIFYTADSLSVESLLELLDEESLRKDTALPSPEWSSDHIALLAEFRCK
PRIRR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgctgagcgtggtgcgggtgcacctgccctcggagatcccgatcgtgggctgcgagatc
acgccctacgtgctgctgcggctgcccaccggcgtcgtctccaccgacgatgtcccggag
gccgcccctgcggatggctacttcatgcggtacagatggtaccgtatacaaagtgatcga
aaagtcgcaatctgcagtgtacatccaatggaacaagcaacaattcagtgccttggttgc
gtcaagtcaaaaatacctgttgctaagagctaccattgttctgctaagtgcttctctgat
gcatggcagcaccatagggtcttgcatgagcgagctagtagtgcattaaacgaaaatgga
gctgaagaagaggagctatttggcagatttggtagcactggttctggggttcttagtact
actggttctggatcgatgtcaaatcttggacagagtcctggtttgaataatggccccgtg
cctttatatccttcaggcactgataagaactcgggtgaaacttggtatgaagtggggcgc
acacggacatatacaccaactgctgatgatattggacatgttctaagatttgaatgcgtg
tctgtggatgctgaaaaaaaggtacctgttggacctccaacttcaattatgacatcccgt
gtgattccagcaccaactccaactccacgtcgccttatccaagtgaatggagatgttttg
agtcacttagatttggacagccaaacatctttcgggacattctcagtgctgtcctacaat
attcttgctgatgcatatgctacaagtgacgcgtatagctactgcccaacatgggcactt
tcttggacatacagaagacagaacttgatgcgtgagattattggttatcatgctgatatc
atctgtcttcaggaggtgcaactgaaccacttcgaagattttttttcacccgagcttgat
aaacatggatatcaggcactttacaagaaaaggacaacagaggtatatactggagctcct
catgccatcgatggctgtgccacctttttccgtagagacaaattttcacacgttaaaaaa
tatgaggttgagttcaataaggctgcacaatcattgacagacgcaattattccctctacc
caaagaagagttgctttgagtcgattgattaaggataatgttgcactgattgcggtttta
gaagctaaattcggcaaccatggaactgacaatcctggcaaaaggcagcttctttgtgtg
gcaaatacacacgtaaatgtccatcaagacctcaaagatgtgaagctgtgggaggttcaa
actctcctaaaagggttggaaaaaatagctgttagtgcggacattccaatgttggtctgt
ggggatttcaattcagtccctgggagttctccacatggacttcttgctatgggcaaagtt
gatcaattgcatccagatctggccatagatccccttggaattttacgccctgcgagcaag
ttaacccatcagcttcctctggtgagtgcatattcttcatttgcaagaatggtcggtgtc
ggctatgatttggagcaccagcggaggaggatggaccctgcaacaaatgaaccacttttc
acaaactgcacacgagatttcactggaacggttgattacatattttacacagcggattca
ttgtcagtggagtcgttgttggaacttttggatgaggaaagtttaagaaaagacacggcc
cttccttctcctgaatggtcttcggatcatatagcactcttggcagaattccggtgcaag
cctagaatcagacggtga

DBGET integrated database retrieval system