KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331742
Entry
4331742           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S28
  KO
K02979  small subunit ribosomal protein S28e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331742
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331742
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4331742
  Archaea
    4331742
SSDB
Motif
Pfam: Ribosomal_S28e
Other DBs
NCBI-GeneID: 4331742
NCBI-ProteinID: XP_015632495
UniProt: A0A8I3B1R5
LinkDB
Position
3:3629784..3631218
AA seq 65 aa
MDTQVKLAVVVKVMGRTGSRGQVTQVRVKFLDDQNRLIMRNVKGPVREGDILTLLESERE
ARRLR
NT seq 198 nt   +upstreamnt  +downstreamnt
atggacacccaggtgaagctggctgttgtggtgaaggtgatggggcgtaccggctccagg
ggtcaggtgacccaggtgagagtcaagttcttggatgaccagaaccgtctcatcatgagg
aacgtcaagggcccggttcgagagggcgacatcctcaccttgctcgagtccgagagggag
gccaggaggcttcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348607
Entry
4348607           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S28
  KO
K02979  small subunit ribosomal protein S28e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348607
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4348607
  Archaea
    4348607
SSDB
Motif
Pfam: Ribosomal_S28e
Other DBs
NCBI-GeneID: 4348607
NCBI-ProteinID: XP_015614739
UniProt: A0A8I3B1R5
LinkDB
Position
10:complement(14323536..14324823)
AA seq 65 aa
MDTQVKLAVVVKVMGRTGSRGQVTQVRVKFLDDQNRLIMRNVKGPVREGDILTLLESERE
ARRLR
NT seq 198 nt   +upstreamnt  +downstreamnt
atggatacccaggtcaaacttgccgtcgtggtgaaggtgatgggccgcaccggctccagg
ggtcaggtgacccaggtcagagtgaagttcctcgacgaccagaaccgtctcatcatgagg
aacgtcaagggcccggtccgtgagggcgacatcctcaccctgctcgagtctgagagggag
gccaggaggctgcgctga

DBGET integrated database retrieval system