KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331761
Entry
4331761           CDS       T01015                                 
Name
(RefSeq) ribulose-phosphate 3-epimerase, chloroplastic
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00040  Pentose and glucuronate interconversions
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4331761
   00040 Pentose and glucuronate interconversions
    4331761
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4331761
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     4331761
SSDB
Motif
Pfam: Ribul_P_3_epim IMPDH Sp38 His_biosynth ThiG TMP-TENI NanE
Other DBs
NCBI-GeneID: 4331761
NCBI-ProteinID: XP_015630737
UniProt: Q9ZTP5
LinkDB
Position
3:3713911..3717248
AA seq 274 aa
MASPSSSSSLCSTFASPRAASLGRRLAFSSPRKAFRVRASSRVDKFSKNDIIVSPSILSA
NFSKLGEQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEP
EQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATPLTAIDYVLDV
VDLVLIMSVNPGFGGQSFIESQVKKIAELRRLCAEKGVNPWIEVDGGVGPKNAYKVIEAG
ANAIVAGSAVFGAPDYAEAIKGIKTSQKPVAVPA
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcgtcgccgtcgtcgtcgtcgtcgctgtgctcgaccttcgcctcgccgcgcgccgcc
tccctcggccgccgcctcgccttctcctcgcccaggaaagcattccgagtgagggcatca
tccagggttgacaagttctcgaagaatgacatcatcgtgtccccttccattctttctgca
aacttttccaagcttggcgagcaggtaaaagctgtggaggtggcaggatgtgactggatt
catgttgatgtcatggatggacgttttgtgccaaatatcacaatcggacctttggttgtt
gatgctctgcggccagtcactgatcttccgttggatgtgcatctgatgattgtggaacct
gagcaacgagttccagattttatcaaggcaggtgctgatattgttagcgttcactgtgag
caatcgtcaaccatccatctacaccgaacagtcaatcagatcaaaagtcttggagcaaag
gctggagttgttttgaatcctgcaacccctctcactgcgatagattatgtacttgatgtt
gttgatctagtattgattatgtcggtgaatcctgggtttggtgggcagagctttattgaa
agccaagtgaagaagattgcagagttgagaagattatgtgcagagaagggagtaaaccct
tggattgaggttgatggtggagttggtcccaaaaacgcctacaaggtcattgaagctggg
gccaacgccattgttgctggttcagccgttttcggggctccagactatgcagaagctatc
aagggaatcaagaccagccaaaaacctgtggctgtaccagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347508
Entry
4347508           CDS       T01015                                 
Name
(RefSeq) ribulose-phosphate 3-epimerase, cytoplasmic isoform
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00040  Pentose and glucuronate interconversions
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4347508
   00040 Pentose and glucuronate interconversions
    4347508
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4347508
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     4347508
SSDB
Motif
Pfam: Ribul_P_3_epim
Other DBs
NCBI-GeneID: 4347508
NCBI-ProteinID: XP_015611665
UniProt: Q9SE42
Structure
LinkDB
Position
9:19566149..19568845
AA seq 228 aa
MAAAAAAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLR
KHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSL
RPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDG
GLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgaagatagcgccgtcgatgctctcgtcggacttcgccaac
ctcgccgcggaggccgaccgcatggtccgcctcggcgccgactggctccacatggacatc
atggacgggcactttgttcctaatcttactattggagctccagtgattcagagcttgagg
aagcacaccaaggcatatttggactgccatcttatggtgaccaatccttcggattatgta
gaaccattagcaaaagctggtgcctcaggtttcacattccatatagaagtatccagagac
aattggcaagaactcatccaaagtatcaaagcaaagggtatgcgaccgggtgtatcattg
aggccaggcactcctgtggaggaagtttttcccctggtggaggcagaaaatcctgttgaa
ttggttcttgttatgacagttgaacctggctttggtggtcagaagtttatgccagaaatg
atggaaaaggtgcgtgccctgagaaagaagtacccatcccttgacatcgaggttgatggt
ggtctgggtccttccaccattgatgtggctgcatctgctggggctaactgcattgtcgct
ggaagctcaatatttggagcagctgaaccaggagaggtcatatcggcactaaggaagagc
gttgaaggatctcagaacaaaagctga

DBGET integrated database retrieval system