KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331779
Entry
4331779           CDS       T01015                                 
Name
(RefSeq) alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4331779
   00260 Glycine, serine and threonine metabolism
    4331779
   00270 Cysteine and methionine metabolism
    4331779
   00280 Valine, leucine and isoleucine degradation
    4331779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4331779
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     4331779
    2.6.1.44  alanine---glyoxylate transaminase
     4331779
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4331779
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4331779
NCBI-ProteinID: XP_015633093
UniProt: Q10R45 A3AEL4
LinkDB
Position
3:3854276..3858339
AA seq 486 aa
MAVSSSSLLLRRGATGGAGRRWGPGEALRRLVSSSEAAPAEKVPARSPPVMPPFEHRPRP
YAGWSGDEILAKRKQFLGSSVFYYYQKPLNIVEGKMQYLYDENGKRYLDCFGGIVTVSCG
HCHPDIVNAVVEQTKLLQHTTTIYLNQPIVEFAEALASKMPGNLKVVYFVNSGTEANELA
MLMARLYSGNLNMIALRNAYHGGSAGTIGLTGLQTWKYPIPQGEIHHVMNPDPYRGTFGS
DAVAYAKEVEEQINYGTSGRVAGFIAETFQGVGGAVELAPGYLKLAYDTVRKAGGVCIAD
EVQSGFGRTGSHYWGFQTQDVIPDIVTMAKGIGNGLPLGAVVTTPEIANVLAQKIQFNTF
GGNPVCSVGGLAVLKVLDKEKRQAHCADVGSHLVNRLKELQQKHEIIGDVRGRGLMLGVE
LVTDRKEKTPAKAETNLLFEKLKDLNILVGKGGLHGNVFRIKPPMCFTRDDADYLVDAMD
YAMSGL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcggtgtcgtcgtcgtcgctgctgctccgccgcggagccaccggcggcgccgggaga
cggtggggtccgggggaggcgttgcggaggctggtgtcgtcgtcggaggcggcgccggcg
gagaaggttccggcgcggtcgccgccggtgatgccgccgttcgagcaccggcccaggccg
tacgccgggtggagcggcgatgagatcctcgcgaagaggaagcagtttcttggatcgtct
gtgttctactactaccagaagccgctgaacattgtggaagggaagatgcagtatctgtac
gatgagaatgggaagagatacctcgattgcttcggaggcatcgtgacagtttcatgcggc
cattgccatccggatatcgtgaacgctgtggtggagcagaccaagctgctccagcacacg
accaccatatatttgaatcaacccatcgtcgagtttgcagaagcgctcgcgtccaagatg
ccaggaaatctcaaggtggtgtattttgtgaattctgggactgaagcgaatgaactggcg
atgctgatggctcggctgtacagtgggaatctcaatatgattgcattgagaaatgcttat
catggtggtagtgctggaacaataggattgacgggtttgcagacgtggaagtacccaatc
cctcagggcgaaatacatcatgtcatgaaccctgatccttaccgtggaactttcggttct
gatgctgtagcttatgccaaggaagtcgaagaacaaataaattatggtacctccggaagg
gttgcgggtttcattgctgaaactttccaaggcgtgggaggtgcagttgaactagctcct
ggatatttaaagttagcttatgacactgtccggaaggctggtggtgtttgtatagctgat
gaagtccagagtggatttggtcgaactggaagtcactattggggatttcagacgcaagat
gttattcctgacattgtaacaatggcaaagggaattggaaatggtctaccattgggggca
gttgtaacaacacccgagattgcaaatgtgctggcgcaaaaaatccaatttaacacattt
ggtggaaaccctgtttgctccgttggtggacttgctgtgctcaaggttcttgacaaggag
aaacgccaggcacattgtgctgatgttggatctcatttggtgaatcgtctaaaagagctc
cagcaaaagcatgaaatcattggagatgttagagggaggggattgatgcttggggtggag
cttgttaccgataggaaggagaagacacctgccaaggccgagaccaatttattgtttgag
aaactcaaggatctcaacattttagttggaaaaggtggtctgcatggtaatgtcttcagg
ataaaaccaccaatgtgctttacaagggatgatgcagattacctggtggatgccatggac
tatgcaatgtcagggctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332775
Entry
4332775           CDS       T01015                                 
Name
(RefSeq) alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332775
   00260 Glycine, serine and threonine metabolism
    4332775
   00270 Cysteine and methionine metabolism
    4332775
   00280 Valine, leucine and isoleucine degradation
    4332775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332775
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     4332775
    2.6.1.44  alanine---glyoxylate transaminase
     4332775
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4332775
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4332775
NCBI-ProteinID: XP_015628667
UniProt: Q10LR4 Q0DS21
LinkDB
Position
3:complement(12556835..12559714)
AA seq 465 aa
MMMQGGRIARRGLSRLAAAVETAAVAPPRMADFNHVPLPYDGPSAAEIARKRAEFLSPSL
FHFYSKPLNIVEGKMQYLFDERGRRYLDAFAGIATVCCGHCHPDVVGAIAAQAGRLQHST
VLYLNHAIADFAEALASKMPGDLKVVFFTNSGTEANELAIMMARLYTGSHDIISLRNSYH
GNAAGTMGATAQKNWKFSVVQSGVHHAVNPDPYRGAFGSDAEKYARDVQEIIEFGTTGQV
AGFISEAIQGVGGIVELSPGYLPLAYEAVRSAGGLCIADEVQAGFARVGSHFWGFETHGV
VPDIVTMAKGIGNGIPLGAVVTTPEIAQVLTRRCYFNTFGGNPLCTAGGLAVLRVLEKEG
LQANAHAVGSYLKDRLRALQDKHEIIGDVRGTGFMLGVELVTDRQLKTPAKDEICRAMEH
MKEMGVLVGKGGFYGNVFRITPPLCFTKEDADFFVAVMDSALSKL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatgatgcaggggggtaggattgcgaggagagggttgtcgaggctcgcagcggcggtg
gagacggccgccgtcgcgccgccgagaatggcggacttcaaccacgtcccgctcccctac
gacggcccgtccgccgccgagatcgcacggaagcgcgccgagttcctcagcccgtccctc
ttccacttttattccaaaccactgaacatcgtggagggtaagatgcagtacctgttcgac
gagcgcgggcggcgctacctggacgcgttcgccggcatcgccaccgtgtgctgcggccac
tgccacccggacgtcgtcggcgcgatcgccgcgcaggccggccgcctgcagcactccacc
gtgctctacctcaaccacgccatcgccgacttcgccgaggcgctcgcctccaagatgccc
ggcgacctcaaggttgtgttcttcaccaactccggcacggaggcgaacgagctcgccatc
atgatggcgcggctgtacaccggctcccacgacatcatatcgctccggaactcctaccac
ggcaacgccgctggcaccatgggcgccaccgcgcagaagaactggaagttcagcgtcgtc
cagagcggcgtgcaccacgccgtgaacccggacccgtacaggggcgcgttcggctccgac
gccgaaaagtacgcgcgcgacgtgcaggagatcatcgagttcggcaccaccgggcaggtc
gccggcttcatatcggaggcgatacagggcgtcggtgggatcgtggagctgtcgccgggg
tacctgccgctggcgtacgaggcggtccggagcgccggcgggctgtgcatcgccgacgag
gtccaggccggcttcgcgcgcgtcggcagccacttctgggggttcgagacccacggcgtc
gtccccgacatagtcaccatggccaagggcatcggcaacggcatcccgctgggcgcggtg
gtgacgacgccggagatcgcgcaggtgctgacaaggcggtgctacttcaacacgttcggt
ggcaacccgctgtgcaccgccggcgggctcgccgtgctccgggtgctcgagaaggagggc
ctccaggcgaacgcccacgccgtcggctcctacctcaaggaccgcctccgcgctctccag
gacaagcacgaaattatcggcgacgtgagggggacgggtttcatgctcggcgtcgagctg
gtgacggacaggcagctcaagacgccggcgaaagacgagatttgccgcgccatggagcac
atgaaagagatgggcgtcttggtcggcaaaggcggcttctacgggaacgtcttcaggatc
actccccctctgtgcttcaccaaggaggatgccgatttcttcgtcgccgtgatggactct
gcactgtccaagctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339095
Entry
4339095           CDS       T01015                                 
Name
(RefSeq) alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4339095
   00260 Glycine, serine and threonine metabolism
    4339095
   00270 Cysteine and methionine metabolism
    4339095
   00280 Valine, leucine and isoleucine degradation
    4339095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4339095
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     4339095
    2.6.1.44  alanine---glyoxylate transaminase
     4339095
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4339095
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4339095
NCBI-ProteinID: XP_015639493
LinkDB
Position
5:complement(23356152..23360048)
AA seq 480 aa
MQRLASSRRLLQAALAPVRAQSSLSAAAAAAAPAPENAFAAAPKMPPFDYTPPPYDGPRA
EEISRKRAEFLSPSLFHFYDRPLNIVDGKMQYLFDEDGRRYLDAFGGIATVCCGHCHPDV
VEAMVNQAKRIQHSTVLYLNHAIADFAEALAAKMPGDLKVVFFTNSGTEANELALMIARL
YTGCHDIISLRNGYHGNAAGTMGATAQCNWKFNVVQTGVHHALNPDPYRGAFGSDGEKYA
RDVQEIIDFGTTGRVGGFISEAIQGVGGIVELAPGYLPAVYNMVRKAGGLCIADEVQAGV
ARTGSHFWGFESHGVIPDIVTMAKGIGNGIPIGAVVTTPEIAQVLTRRSYFNTFGGNPVS
TAGGHAVLKVLEKEKLQENAFVVGSYLKERLNKLKEKHDIIGDVRGKGFLLGVELVTDRQ
KKTPAKVEIGHVMNHMKDMGVLVGKGGFYGNVFRVTPPLCFTKEDSDFFIEAMDISLSKL
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcagcgcctcgcctcctcccggaggctcctccaggcggcgctcgcccctgtccgtgcc
cagtccagcctctccgccgcggcggccgccgccgcgcccgcgccggagaatgccttcgcc
gccgccccgaagatgccgccgttcgactacacgccgccgccgtacgacgggccgcgggcg
gaggagatctcccggaagcgggccgagttcctcagcccctccctcttccacttctacgac
cgccctttgaacatagtcgatgggaaaatgcagtacctgttcgacgaggatggccgccgt
tacctggatgcttttggtggcattgcaaccgtttgttgcgggcactgccatccggatgtt
gttgaggcgatggtcaaccaagcaaagaggatacaacactccacagttctttacctgaat
catgctattgcagattttgccgaggcattggcagccaaaatgcctggtgatctgaaggtt
gttttcttcacaaattctggcacggaggcgaacgagcttgcactgatgattgcccggctt
tacactggttgccatgacattatttcactcaggaatggataccacgggaatgcggctgga
acaatgggtgctaccgctcaatgcaactggaaatttaatgttgttcagacgggagtgcac
catgcacttaatccagacccatatagaggtgctttcggttctgatggcgaaaagtatgcc
cgagatgttcaggaaatcattgattttggaactacaggaagggtcggtggtttcatttcg
gaagccatacagggagtgggtggaatagtggaactggcaccaggatacttgcctgctgtg
tacaatatggtaaggaaagctggcggcctctgcatcgccgacgaagttcaggcgggagtc
gcacgaactggaagccacttctggggatttgaatcgcacggcgtcatcccagacatagtt
acaatggcaaagggtataggcaatggcataccgatcggagcagtcgtcacaacccctgag
atcgctcaggtgttaacccgcaggagctacttcaacaccttcggtggcaaccctgtcagc
acagccggtggccatgctgttctcaaggttctggagaaggagaagctccaggagaacgca
tttgtggttggctcctacctgaaggaacggctcaacaagctgaaagagaagcatgacatc
attggtgatgttagagggaaaggcttccttcttggggttgagctggtgaccgatcgccag
aagaagacaccggccaaagttgagatcggtcatgtcatgaaccacatgaaagacatgggt
gtgctggttgggaaaggtggtttctacgggaacgtgttcagagtaacacctccactatgc
ttcaccaaagaggactccgatttcttcattgaggcgatggacatttcactatcgaagctg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342210
Entry
4342210           CDS       T01015                                 
Name
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4342210
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4342210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4342210
   00260 Glycine, serine and threonine metabolism
    4342210
   00220 Arginine biosynthesis
    4342210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4342210
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4342210
    2.6.1.4  glycine transaminase
     4342210
    2.6.1.44  alanine---glyoxylate transaminase
     4342210
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4342210
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4342210
NCBI-ProteinID: XP_015646972
UniProt: Q69UU3 A3BFU9
LinkDB
Position
7:complement(446223..451438)
AA seq 485 aa
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345962
Entry
4345962           CDS       T01015                                 
Name
(RefSeq) serine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4345962
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4345962
   00260 Glycine, serine and threonine metabolism
    4345962
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4345962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4345962
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     4345962
    2.6.1.45  serine---glyoxylate transaminase
     4345962
    2.6.1.51  serine---pyruvate transaminase
     4345962
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class V
   4345962
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 4345962
NCBI-ProteinID: XP_015650532
UniProt: Q6ZFI6 Q6ZJZ3
LinkDB
Position
8:complement(24828142..24830915)
AA seq 402 aa
MADYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTT
GTPFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGY
GADLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLSAVRKILDKHRHPALLLVDGVSS
ICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYLK
FYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQ
KEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQL
MGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggactacgtgtatgggccggggcggaaccacctgttcgtgcctgggccggtgaac
atcccggaccaggtgatccgcgccatgagccgtcagaacgaggactaccgctcgccggcg
gtgcccgccctcaccaagaccctcctcgaggacgtcaagcagatcttcaagaccaccacc
ggcacccccttcctcttccccaccaccgggacgggggcgtgggagagcgcgctgacgaac
acgctgtcgccgggggacaagatcgtgtcgttcctgatcgggcagttcagcctgctgtgg
atcgaccagcagcaacgcctcaacttcaacgtggacgtggtggagagcgactggggctac
ggcgccgacctcgccgccctcgactacaagctccgccaggacccctcccactccatcaag
gccatctgcatcgtccacaacgagaccgccactggagtcaccaacgacctttccgccgtc
cgcaaaatcctcgacaagcacaggcacccggcgctactactggtggacggggtgtcatcg
atatgtgcgttggacttccgcatggatgagtggggagtggacgtggcgctgacgggttcg
cagaaggcgctctcgctgccgacgggtctgggcatcgtgtgcgcgagccccaaggcgctg
gaggcgagcaagacggccaagtcggtgcgggtcttcttcgactggaaggactacctcaag
ttctacaagatgggcacctactggccctacaccccatccatccagctcctctacggcctc
cgcaccgccctcgacctcatcttcgaggaaggcctcgagaacgtcatcaagaggcacaac
cgcctcggcaccgccaccaggctggccgtggaggcgtgggggctcaagaactgcacgcag
aaggaggagtggttcagcgacaccgtcaccgccgtcgtcgtgccgccgtacatcgacagc
gccgagatcgtgaagcacgcctggaagcggtacaacctcagcctcggcctcggcctcaac
aaggtcgccggcaaggtgttcaggatcggccacctcggccacctcaacgagctgcaattg
atgggtgccctgagtggagtggagatggtgctcaaggacatcggctacccggtgaagctc
ggctccggcgtggcggcggcggcggcgtacctgtcgaattcgacgccgctcatcccgtcc
aggatctga

DBGET integrated database retrieval system