KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331801
Entry
4331801           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4331801
  KO
K03137  transcription initiation factor TFIIE subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4331801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4331801
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     4331801
SSDB
Motif
Pfam: TFA2_Winged_2 TFIIE_beta
Other DBs
NCBI-GeneID: 4331801
NCBI-ProteinID: XP_015630069
UniProt: A0A8J8XUH9 B9FBM0
LinkDB
Position
3:4047642..4050347
AA seq 288 aa
MALHERLNKFRQQQERCQTTLSSIAANQASTPRSNITRWVQPTNGPSTPAKPPQRKFSDD
TERLQRINSVRKSPAAAQIKIVIELLEKTRQALTADQINEATYVHIHGNKEVFDRLKNNP
KVHFVGNLFSYKSKYGVNGKDKLLSLIRKFPDGLAVAEIKDAYLAVLEDLKALKASGVVC
LVASTTKSDEGVVYPEIDPMSKIKFDDDLKELARSILLPRDMLDIEKELQKNGQPTRTNA
AKRRADAQILLYPPKPNKSKKKPRGLTSRTKLTNAHLPGLFLGFRFFF
NT seq 867 nt   +upstreamnt  +downstreamnt
atggctcttcatgagcggctgaacaaatttagacagcagcaggagaggtgccagacaact
ctatccagtattgctgcaaaccaagcttcaactccaagatcaaatatcactcgatgggtt
caaccaacaaatggtccatccactccagcaaaaccaccacagcgtaaattctcagatgat
acagagaggttgcagcgcatcaattcagttaggaagtctcctgctgcagcacagatcaaa
atagtaattgaattgcttgaaaagacaagacaggctttaactgcagatcaaataaatgaa
gcaacttatgttcatattcatggcaacaaggaggtctttgacaggttgaagaataatccg
aaagtacactttgtcggcaaccttttctcttacaagtccaagtatggtgtgaacggaaaa
gataaactattatcgttgattagaaagtttcctgacggtcttgctgtcgcggagatcaag
gatgcttatctagctgtattggaagatcttaaggctctcaaagcctcaggcgtcgtctgc
ttggtggcgtccaccacaaaatccgacgaaggcgtcgtgtaccccgaaattgatccaatg
tcgaaaatcaagttcgacgatgacttgaaggagctggcccgttcgatattgctgccacgg
gacatgctggacattgagaaggagctccagaagaatggccaaccaacaaggactaacgca
gccaagaggcgagcagatgcccagatccttttatatccaccaaagcccaacaagtccaag
aaaaagccgcgtgggctcacgagcaggacgaagctcactaacgcacatctgcctggactt
tttttgggttttagattttttttttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348554
Entry
4348554           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4348554
  KO
K03137  transcription initiation factor TFIIE subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4348554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4348554
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     4348554
SSDB
Motif
Pfam: TFA2_Winged_2 TFIIE_beta
Other DBs
NCBI-GeneID: 4348554
NCBI-ProteinID: XP_015614656
UniProt: A3C4G9 Q8RU47
LinkDB
Position
10:complement(13353101..13357384)
AA seq 279 aa
MDLKDSLSKFKQQQERCQSSLASIAASTSKPKHRAQPVNAPSAPARPLQPIKFSNDTERL
QHINSVRKSPIGAQIKLVIELLYKTRQAFTAEQINETTYVDIHGNKSVFDSLRNNPKVHY
DGRRFSYKSKHDLKGKDQLLVLVRKYPEGLAVVEVKDAYPTVMEDLQALKAAGEVWLLSN
MDSQEDIVYPNDPKAKIKVDDDLKQLFREMELPRDMVDIEKELQKNGIKPMTNTAKRRAA
AQINGVQPKAKPKKKQREITRRTKLTNAHLPELFQNLNT
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatctcaaggatagcctctccaaatttaagcagcagcaagagaggtgccaatcatct
ttggccagcatagctgcatcgacctcaaaaccaaagcacagggcccaaccggttaatgct
ccatccgctccagcaaggccactacaacctattaagttttcaaatgatacagaaaggcta
caacacatcaattcagttaggaaatctcctattggagcacagatcaaacttgtcattgaa
ttgctgtacaagacaagacaagcttttactgcggagcaaataaatgaaacaacttatgtt
gatatccatgggaataagtctgtctttgacagtctgaggaacaatcctaaagtacattat
gatgggagacgtttctcttacaagtccaagcatgatttgaagggaaaagatcaactactt
gttttggtaagaaagtatccggagggtcttgctgtggtggaagtcaaggatgcgtaccca
actgtaatggaagatttgcaggcactgaaggcagcaggtgaagtttggctgttatcgaac
atggattcccaggaggacattgtgtatcctaacgacccaaaggcaaagatcaaggtcgac
gatgacctgaagcagctcttccgggagatggagttaccgcgggacatggtggatatcgag
aaggagctccagaagaatggcatcaagcccatgaccaacacagctaaacggcgggctgca
gcacagatcaatggggtgcagcccaaggctaagcctaagaagaagcagcgtgagatcaca
cgccggaccaagctcacgaacgcccatctgcctgagctgttccagaacctcaacacttga

DBGET integrated database retrieval system