KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331831
Entry
4331831           CDS       T01015                                 
Name
(RefSeq) UDP-glycosyltransferase TURAN isoform X1
  KO
K03842  beta-1,4-mannosyltransferase [EC:2.4.1.142]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4331831
   00513 Various types of N-glycan biosynthesis
    4331831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4331831
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.142  chitobiosyldiphosphodolichol beta-mannosyltransferase
     4331831
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4331831
SSDB
Motif
Pfam: Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glycos_transf_1 Glyco_trans_1_2 Glyco_trans_4_2
Other DBs
NCBI-GeneID: 4331831
NCBI-ProteinID: XP_015630353
UniProt: Q10QW6 B9F5I4
LinkDB
Position
3:complement(4223434..4228510)
AA seq 473 aa
MAVALEAGRRKRAAVVVLGDIGRSPRMQYHSLSLANQAGMEVDIVANGGSDPHLLLRENP
SIHIHEMKSVQLTGILKISGALTLLLKAAIQFIILIWYLCFKIPRPDVFIVQNPPSVPTL
AAVKLASWLRGAKFIVDWHNFGYTLLGLSHGRSHIIVKIYFWFEKHFGRMADGAFCVTKA
MKHELDQKWGINATVLYDQSPEFFHPASLTEKHELFSRLGNSICSAMGNDDCISVEKEVE
DRNTTVFTSWVDGEIFLKPNRPALVVSSTSWTPDEDFSILLEAALMYDRRVAATLGEDDS
MDEGKLWIDIKNGKQFVYPRLLFIITGKGPDRMKYEEQIKRLKLRRVAFRTMWLASEDYP
LLLGSADLGVSLHTSSSGLDLPMKVVDMFGCGLPVCAASFSCIDELVKINNNGLLFSTSS
ELADELMMLFKGFPEECDDLKSLKVGALNTGSSSKWSTEWERYALPLVNQVIG
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggccgtggcactagaggcagggaggaggaagcgagcggcggtggtagttctgggagac
attgggcgcagcccgcgcatgcagtaccactccctctccctcgccaaccaggctggtatg
gaagtggacattgttgcaaatggaggaagtgacccgcatctattattgagagaaaatcca
tcaattcacatccatgaaatgaaatcagtgcagttaacaggaatattaaagatatccggt
gccctgacactgctacttaaagctgccatccagtttatcatattgatttggtacctttgt
ttcaagattcctcgccctgatgtcttcattgttcagaatccaccctctgttccaacattg
gctgctgtaaaactggctagctggctaagaggtgctaagtttattgtggactggcataac
tttggatatacactgcttgggttgtctcatggcagaagccatatcattgttaaaatctac
ttctggttcgagaagcattttggacggatggctgatggtgccttctgtgttacaaaagca
atgaaacacgagcttgatcaaaaatggggaatcaacgcaacagttctttacgatcaatct
cctgaatttttccatcctgcttcattgacagagaaacatgagttgtttagcaggttgggg
aattccatttgtagtgctatgggcaatgacgattgcatttctgttgagaaagaagtggaa
gacaggaacactactgtatttacaagctgggtcgatggtgaaattttcttgaagcctaat
agaccagctcttgttgtcagcagcacaagctggacaccagatgaagatttcagcatactt
ctggaagcagcacttatgtacgatagacgtgttgctgcaactttaggagaagatgattca
atggacgagggaaagctttggattgatatcaagaacgggaagcaatttgtctacccaaga
ctgctattcattatcactggcaaaggacctgataggatgaagtatgaggagcaaataaag
aggttgaaactgaggcgtgttgccttccggactatgtggcttgcatcagaggactaccct
cttttgcttggatcggctgatctaggtgtatcattgcatacttcctcttcagggctagac
ctacctatgaaggtggttgatatgttcggttgtggattaccagtttgtgctgcttcattc
tcctgcattgatgagcttgtaaaaataaataataatggacttcttttttcaacatcttct
gagcttgccgatgaacttatgatgctctttaaggggtttccggaagaatgcgatgacttg
aaatccctcaaggttggtgccttgaatactgggtcatcttccaaatggtcgacagaatgg
gaacgttatgcactccccttggtgaaccaggtcataggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341323
Entry
4341323           CDS       T01015                                 
Name
(RefSeq) UDP-glycosyltransferase TURAN isoform X1
  KO
K03842  beta-1,4-mannosyltransferase [EC:2.4.1.142]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4341323
   00513 Various types of N-glycan biosynthesis
    4341323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4341323
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.142  chitobiosyldiphosphodolichol beta-mannosyltransferase
     4341323
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4341323
SSDB
Motif
Pfam: Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4341323
NCBI-ProteinID: XP_015641554
LinkDB
Position
6:complement(21734400..21747974)
AA seq 482 aa
MATAVEAGRRRRAAAVVLGDIGRSPRMQYHSLSLANQGGMEVDIVANGGSDPHLLLRENP
LIHIHEMKSVQLTGISKISGALSMLLKAAIQFIILIWYLCFKIPRPDVFIVQNPPSVPTL
AAVKLASGLRGAKSIVDWHNFGYTLLGLSHGRSHIIVKIYFWFEKHFGRMADGAFCVTKA
MKHELDKKWGINATVLYDQSPEFFHPASLTEKHELFSRLGNSICSAMGNDDCISIVSTVF
SYNTEKEVEDRNTTVFTGRVDGEIFLKPNRPALVVSSTSWTPDEDFSILLEAALMYDRRV
AATLGEDDSMDEGKLWIDIKNGKQFVYPRLLFIITGKGPDRKKYEEQIKRLKLRRVSFRT
MWLASEDYPLLLGSADLGVSLHTSSSGLDLPMKVVDMFGCGLPVCAASFSCIDELVKVNN
NGLLFSTSSELADELTMLFKGFPEECDELKSLKVGALNTGSSSKWSTEWERYALPLVNQV
IG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggccacggcagtggaggcagggaggaggaggcgcgcagcggcagtagttttaggagac
attgggcgcagcccgcgcatgcagtaccactccctctccctcgccaaccagggtggtatg
gaagtggacattgttgcaaatggaggaagtgacccacatctattattgagagaaaatcca
ttgattcacatccacgaaatgaaatcagtgcagttaacaggaatatcaaagatatctggt
gccctgtcaatgctacttaaagccgccatccagtttatcatattgatttggtacctttgt
ttcaagattcctcgccctgatgtcttcattgttcagaatccaccctctgttccaacattg
gctgctgtaaaactggctagcgggctaagaggtgctaagtctattgtggattggcataac
tttggatatacactgctcgggttgtctcatggcagaagccatatcatagttaaaatctac
ttctggttcgagaagcattttggacggatggctgatggtgccttctgtgttacaaaagca
atgaaacatgagcttgataaaaaatggggaatcaatgcaacggttctttatgatcaatct
cctgaatttttccatcctgcttcattgacagagaaacatgaattgtttagcaggttgggg
aattccatttgtagtgctatgggcaatgatgattgcatctccattgtttctactgttttc
tcttacaacacagagaaagaagtggaagacaggaacactactgtatttacaggccgggtc
gatggtgaaattttcttgaagcctaacagaccagctcttgttgtcagcagcacaagctgg
acaccagatgaagatttcagcatacttttggaagctgcacttatgtacgatagacgcgtt
gctgcaactttaggagaagatgattcaatggatgaggggaaactttggattgatattaag
aatgggaagcaatttgtctacccaagactgctattcattatcactggtaaaggacctgat
aggaagaagtatgaggagcaaataaagaggttgaaactgaggcgtgtttccttcaggacc
atgtggcttgcgtcagaggactaccctcttttgcttggatcggctgatcttggtgtatca
ttacatacatcctcttcagggctagacctacctatgaaggtggttgatatgtttggatgt
ggattaccagtttgtgctgcttcattctcctgcattgacgagcttgtaaaagtaaataat
aatggacttcttttctcaacatcttctgagctcgccgatgaacttacgatgctctttaag
gggtttccagaagaatgcgatgagttgaaatccctcaaggttggtgccttgaatactggg
tcatcttcaaaatggtcgacagaatgggaacgttatgcactccccttggtgaatcaggtc
ataggttga

DBGET integrated database retrieval system