KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331873
Entry
4331873           CDS       T01015                                 
Name
(RefSeq) vacuolar protein-sorting-associated protein 37 homolog 1 isoform X1
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4331873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331873
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331873
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    4331873
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4331873
  Exosomal proteins of colorectal cancer cells
   4331873
SSDB
Motif
Pfam: Mod_r APG6_N Hamartin TMF_TATA_bd CDT1 TBPIP MAGE_N
Other DBs
NCBI-GeneID: 4331873
NCBI-ProteinID: XP_015628650
UniProt: A0A8J8Y469 Q10QR5
LinkDB
Position
3:4532875..4536629
AA seq 234 aa
MSWRFPLFGSNSQQQQPDPNFQDNPTQPWYPQSVVGSSSHPSTPSSSNVGPHQRASDNSQ
SSSRAQPSPAEAAGIIARLKDKSVDELQRLLKDKEAYNAFFNSLDQVKTQNNLRDELRKE
TVQLARENLEKEQRILELRNQCTIIRTTELAAAQDRLAELERQKDEIMRSYSPAALLDKL
QKSMAKLDEESEELHQKFLEKDIDLPTFVQKYKKLRAAYHKQALLHLAGKTSLR
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagctggagatttcctctttttggcagcaactcgcagcagcagcaacctgatccaaat
ttccaggacaaccctacgcaaccttggtaccctcagtctgtagttggttcatcttcacat
ccatccacaccaagctcttccaatgttggtccacatcaaagagcttctgataattcccag
tcttcatcgcgtgctcaaccatctccagctgaggctgcagggataattgctcggttaaag
gacaaaagtgttgatgagttgcagaggctgttgaaagacaaagaggcatataatgctttc
ttcaattcactcgatcaagttaaaacccagaacaacttacgcgatgagcttagaaaggag
acagtgcaacttgcaagagaaaatttggaaaaagagcaacggatcttggagctcaggaat
cagtgcaccattataagaactacagaactagctgctgctcaagataggttggctgagttg
gaaaggcaaaaggatgagattatgaggtcatattctcctgctgcactgctcgacaagctc
caaaaatcgatggcaaagttggacgaggagtcggaggagctgcaccagaagttcctggag
aaggacattgacctcccaacctttgttcagaagtacaaaaagctccgcgccgcctaccac
aagcaggcgttgctccatctcgccggcaagacctcacttcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333290
Entry
4333290           CDS       T01015                                 
Name
(RefSeq) vacuolar protein-sorting-associated protein 37 homolog 1 isoform X1
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4333290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333290
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333290
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    4333290
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4333290
  Exosomal proteins of colorectal cancer cells
   4333290
SSDB
Motif
Pfam: Mod_r APG6_N CDT1 TBPIP TMF_TATA_bd GlutR_dimer
Other DBs
NCBI-GeneID: 4333290
NCBI-ProteinID: XP_015628046
UniProt: Q10HX5 A0A5S6R6T6
LinkDB
Position
3:complement(20842075..20846883)
AA seq 232 aa
MSWRFPLFGSSQQQQPDTNFQDNPTQPWYPPSVLGSSSHPSLPSSSSGSPHQRASDNPQS
LHGQPSPAEAAGIIARLKDKSVDDLQRLLKDKEAYSAFFNSLDQVKTQNNLRDELKKETV
QLARDNLEKEQRISEIRNQCTIIRTTELAAAQDRLADLERQRDEVMKSYSPAALLDKLQK
LMAKLDEESEELHQKFLEKDIDLPTFVQKHKKLRTAYHKQALLHLAGKTSVR
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagctggagatttcctcttttcggcagctcgcagcagcagcaacctgatacaaatttc
caggacaaccctacacaaccatggtaccctccgtctgtccttggttcatcttcacatcca
tccctgcccagctcgtccagtggtagtccacatcaaagagcttctgataatccccaatca
ttgcatggtcagccatctccagctgaggctgcagggataattgctcgcttaaaggacaaa
agtgttgatgacttgcagagactgttgaaagacaaagaggcatacagtgctttcttcaat
tcactcgatcaagttaaaacccagaacaatttgcgggatgagcttaaaaaggagacagtg
caacttgcaagggataatttggaaaaggaacagcggatctcggagattaggaatcagtgc
actattataagaactacagaactagctgctgctcaggataggttggctgatttagaaagg
caaagggatgaggttatgaagtcgtattcccctgctgcactgctcgacaagctccaaaaa
ttgatggcgaagttagatgaggagtctgaggagctgcatcagaagttcctggagaaggac
attgacctccctacctttgtgcagaagcacaagaagctccgaactgcctaccacaagcag
gcattgctccatctcgccggcaagacctcggttcgctga

DBGET integrated database retrieval system