KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331882
Entry
4331882           CDS       T01015                                 
Name
(RefSeq) bet1-like protein At4g14600
  KO
K08505  protein transport protein SFT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4331882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331882
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Sft1
    4331882
SSDB
Motif
Pfam: AI-2E_transport DUF2207 Dynamitin SlyX
Other DBs
NCBI-GeneID: 4331882
NCBI-ProteinID: XP_015628767
UniProt: Q8H7P3 Q0DUG2
LinkDB
Position
3:4596030..4598260
AA seq 124 aa
MASGAYGSREGLTARPAASSSSSEISLQIDPITADLDDHIVGLRGQVRKLRGVAQEIQTE
AKYQNDFISQLQMTLTKAQAGVKNNMRRINKKIIQNGSNHLFHVILFALVCFFLVYLVSK
FSRR
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcgagcggcgcctacggttcaagggaagggctgacggccaggccggctgcatcatca
agctccagcgagatttcgctccagatcgacccaattaccgctgatttggatgaccatatt
gtcggacttcgtgggcaagtccgtaagctaagaggggttgcccaagagatccaaacagag
gccaagtaccaaaatgatttcatctctcagctgcaaatgactctgacaaaggcccaggca
ggcgtcaagaataacatgaggagaataaacaagaaaatcatacagaatggttcgaaccat
ctttttcatgtaatcctcttcgctctcgtctgcttctttctagtgtacctcgtgtccaag
ttctctaggagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343711
Entry
4343711           CDS       T01015                                 
Name
(RefSeq) bet1-like protein At4g14600
  KO
K08505  protein transport protein SFT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4343711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343711
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Sft1
    4343711
SSDB
Motif
Pfam: RSN1_TM
Other DBs
NCBI-GeneID: 4343711
NCBI-ProteinID: XP_015645414
UniProt: Q0D567 Q6ZL92
LinkDB
Position
7:complement(23371560..23373943)
AA seq 121 aa
MANPLHGSGPLRSRNASSSDEIQLRIDPVHGDLDEEIDGLHSRVRLLKGVAQEINAEAKF
QNDFLSQLQMTLIKAQAGVKHNMRRMNKSIIQQGSNHVVHVVLFALFCFFVVYLLSKFSR
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcgaacccgctgcacggctcgggtccgcttcgatccaggaatgcgtcgagctcggac
gagatccagctgcggatcgatccggtgcacggcgatcttgatgaggagatcgatgggctg
cactcgagggttcgcctactgaaaggcgtggcccaggagataaatgctgaagccaagttc
cagaatgatttcctcagccaactgcaaatgaccctcataaaagctcaggctggagtgaag
cataacatgcgaaggatgaacaagagcatcatccaacagggctcgaatcatgttgtgcac
gtggtcctttttgctctgttttgcttcttcgttgtctatctcttgtcaaagttctctaga
agataa

DBGET integrated database retrieval system