KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331897
Entry
4331897           CDS       T01015                                 
Name
(RefSeq) 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic isoform X1
  KO
K23094  2-carboxy-1,4-naphthoquinone phytyltransferase [EC:2.5.1.130]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4331897
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.130  2-carboxy-1,4-naphthoquinone phytyltransferase
     4331897
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 4331897
NCBI-ProteinID: XP_015627851
LinkDB
Position
3:complement(4697239..4700189)
AA seq 374 aa
MPLAGIALAPLFVSHLAPPHHRRSSVASAAAAAARRRPRAVQCSATATAASGEGAGDDVE
LSRGTLLWRAAKLPIYSVALVPLTVGSACAYHHVGSFFGKRYFVLLVASVLVITWLNLSN
DVYDSDTGADKNKKESVVNIVGSRTMTQYAANISLLFGFMGLFWAFAQAGDARFILSVTC
AIICGYVYQCPPFRLSYRGLGEPLCFAAFGPLATTAFYFSNSSRNISRCFNYSGTALLPL
SKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKTGSRLVTLGVVTLYV
LLAAFGMSKSLPSACTVLCALTLPVGKWVVDYVLKNHEDNSKIFMAKYYCVRLHALFGMA
LASGLVLARNGTLV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgccgctcgccggcatcgccctcgcgcctctcttcgtctcccacctcgcgcctccacat
catcgccgcagcagcgttgcttccgccgccgccgccgccgcgagaaggaggccgcgcgcg
gttcagtgctccgctaccgctactgccgcgtccggtgaaggcgcaggagacgacgttgag
ctctcccgagggacgctgctctggagggcggcaaagctgccaatctactccgtggcgctt
gtgccactcacggttggaagcgcctgtgcttaccatcatgtgggttcattctttggtaaa
cggtattttgttctcttggttgcatcagtccttgtgatcacttggctcaatctaagcaat
gatgtttacgattcagatactggggctgataagaacaagaaggaatctgttgttaacatc
gttggcagtcgaacgatgacgcaatatgctgcaaatatttctctcctgttcggatttatg
gggctattttgggcctttgcccaagctggggatgccaggttcattttatcggtaacctgt
gcaatcatctgtggctatgtttatcagtgcccaccattccgactaagttacaggggacta
ggtgaaccattatgttttgctgcatttggtccattggcaaccacagctttctacttctca
aacagcagcagaaacatttccagatgcttcaattacagcggaacagctcttctccctctc
agtaaaacagtcattgcttcatccattctagttgggctgacgactaccctgatactcttc
tgcagccattttcatcagattgatggagatcgtgctgttgggaaaatgtctcccctggta
agaattggcaccaaaacaggatcaagattagtgactcttggggttgtcacgctttatgtt
cttttggctgcttttggcatgagcaaatctcttccatcagcttgcactgtcctttgtgcc
ttgacactccctgtgggcaaatgggttgtggactatgtgctgaaaaaccatgaagacaac
agcaagattttcatggcaaagtattactgtgttcggctacatgctctgtttgggatggca
ctggcttctggtttagtcttggctagaaatggcacactggtctga

DBGET integrated database retrieval system