KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331917
Entry
4331917           CDS       T01015                                 
Name
(RefSeq) inositol-3-phosphate synthase
  KO
K01858  myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4331917
Enzymes [BR:osa01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     4331917
SSDB
Motif
Pfam: NAD_binding_5 Inos-1-P_synth
Other DBs
NCBI-GeneID: 4331917
NCBI-ProteinID: XP_015632437
UniProt: O64437
LinkDB
Position
3:complement(4825696..4829742)
AA seq 510 aa
MFIESFRVESPHVRYGAAEIESDYQYDTTELVHESHDGASRWIVRPKSVRYNFRTTTTVP
KLGVMLVGWGGNNGSTLTAGVIANREGISWATKDKVQQANYYGSLTQASTIRVGSYNGEE
IYAPFKSLLPMVNPDDLVFGGWDISNMNLADAMTRAKVLDIDLQKQLRPYMESMVPLPGI
YDPDFIAANQGSRANNVIKGTKKEQMEQIIKDIREFKEKSKVDKVVVLWTANTERYSNVC
VGLNDTMENLLASVDKNEAEISPSTLYAIACVMEGIPFINGSPQNTFVPGLIDLAIKNNC
LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKS
NVVDDMVSSNAILYELGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIVLHNTC
EDSLLAAPIILDLVLLAELSTRIQLKAEGEEKFHSFHPVATILSYLTKAPLVPPGTPVVN
ALAKQRAMLENIMRACVGLAPENNMILEYK
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgttcatcgagagcttccgcgtggagagcccgcacgtgcggtacggcgcggcggagatc
gagtcggactaccagtacgacacgacggagctggtgcacgagagccacgacggcgcctcc
cgctggatcgtccgccccaagtccgtccgctacaacttccggaccaccaccaccgtcccc
aagctcggggtgatgctcgtggggtggggcggcaacaacggctcaacgctgacggctggg
gtcatcgccaacagggagggaatctcatgggcgaccaaggacaaggtgcagcaagccaac
tactatggctcactcacccaggcgtccaccatcagggtcgggagctacaacggggaggag
atctacgcgcccttcaagagcctcctgcccatggtgaaccctgatgaccttgtgttcggg
ggctgggacattagcaacatgaacctggctgatgctatgaccagggcaaaggtacttgac
attgatctgcagaagcagctcagaccttacatggagtccatggtgcctctccccggcatc
tatgaccccgacttcatcgccgccaaccagggatcccgcgcgaacaatgtcatcaagggc
accaagaaggagcagatggagcagatcatcaaggacatcagggagttcaaggaaaagagc
aaagtggacaaggtggtggtgttgtggactgcaaacactgaaaggtacagcaatgtctgt
gttgggctcaatgacacaatggagaacctcctggcgtctgtggacaagaacgaggcggag
atatcaccatcgacactgtatgccattgcctgcgtcatggagggtataccgttcattaac
gggagtcctcagaacacctttgtgcctgggctgatcgatcttgctattaagaacaactgc
ctgattggtggtgatgatttcaagagtggacagacaaagatgaagtctgtcttggttgat
ttcctagttggtgctggaataaagcccacctcaattgtcagctacaaccacttggggaat
aatgatggcatgaacctttccgcacctcaaacattccgatccaaggagatctccaagagc
aatgtggtcgatgacatggtctcaagcaatgccatcctctatgagcttggcgagcatcct
gatcatgttgttgtgatcaagtatgtgccgtatgttggagacagcaagagggcaatggac
gagtacacctcagagatcttcatggggggtaagagcaccatcgttctgcacaacacctgt
gaggactcactccttgccgcgccgatcattcttgatctggtgctccttgccgagctcagc
accaggattcagctgaaagccgagggggaggagaagttccattccttccatccagtggct
accatcctgagctacctcaccaaggcaccccttgttcctcctggcacaccagtggtgaac
gccctggcaaagcagagggcaatgcttgagaacatcatgagggcctgcgttgggctggcc
cccgagaacaacatgatcctggagtacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348467
Entry
4348467           CDS       T01015                                 
Name
(RefSeq) inositol-3-phosphate synthase
  KO
K01858  myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4348467
Enzymes [BR:osa01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     4348467
SSDB
Motif
Pfam: NAD_binding_5 Inos-1-P_synth RE_endonuc Calpain_inhib
Other DBs
NCBI-GeneID: 4348467
NCBI-ProteinID: XP_015614733
UniProt: Q8S5N2
LinkDB
Position
10:11624379..11629492
AA seq 509 aa
MFVEGFRVESPRVRYGDGEIESEYRYDTTEVVAPPSPEKGWVVRPKSVTYHFKTTTTVPK
LGVMLVGWGGNNGTTLTAGVIANREGISWATKEKVHKANYFGSLTQSSTIRVGSYNGEEI
YAPFKSLVPMVNPNDIVFGGWDISSMNLADAMTRARVLDIDLQKQLRHHMESMVPLPGVY
NPDFIAANQGSRANNVIKGTKKEQVEQVKKDIREFKEKSKVDKVVVLWTANTERYSNVVA
GMNDTMDNLLASLDKDEPEMSPSTLYAIACVMEGVPFINGSPQNTFVPGLIELAIKKNSV
IGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIASYNHLGNNDGMNLSAPQTFRSKEISKSG
VVDDMVSSNAILYEPGEHPDHVIVIKYIPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCE
DSLLAAPIILDLVLLAELSTRIQLKAEDQDKYHSFHPVATILSYLSKAPLVPPGTPVVNA
LAKQRAMLENILRACVGLAPENNMMLEYK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgttcgtggagggcttcagggtggagagcccgcgcgtgcggtacggcgacggggagatc
gagtcggagtaccgatatgacacgacggaggtggtggcgccgccgtcgccggagaagggg
tgggtcgtccgccccaagtccgtcacctaccacttcaagaccaccaccaccgtccccaag
ctcggggtgatgctggttggatggggaggcaacaacggcaccacgctcacggctggtgtc
atcgccaacagagagggaatttcatgggcgaccaaggagaaggtgcacaaggccaactac
tttggttccctgacacaatcatccaccatcagggttgggagctacaacggggaggagatc
tatgcgccttttaagagccttgtacccatggtaaacccaaacgacatcgtgttcggtggg
tgggacatcagcagcatgaacctggccgacgccatgaccagggctcgggtgctggacatc
gacctgcagaagcagctccggcatcacatggagtccatggtgcccctccccggcgtctac
aaccctgacttcatcgccgccaaccagggctcccgcgccaacaatgtcatcaagggcacc
aagaaggagcaggtcgaacaggtcaagaaggacatcagggagttcaaggagaagagcaag
gtggacaaggtggtggtgctgtggacggccaacacggagcggtacagcaacgtggtggcc
gggatgaacgacaccatggacaacctgctggcgtcgctggacaaggacgagccggagatg
tcgccgtcgacgctctacgccatcgcctgcgtcatggagggcgtccccttcatcaacggc
agcccccagaacaccttcgtgcccgggctgatcgagctcgccatcaagaagaactcggtg
atcggcggcgacgacttcaagagtgggcagaccaagatgaagtccgtcctcgtcgacttc
ctcgtcggcgccggcatcaagccgacgtcgatcgcgagctacaaccacctaggcaacaac
gacggcatgaacctgtcggcgccgcagacgttccggtccaaggagatctccaagagcggc
gtcgtcgacgacatggtctccagcaacgccatcctctacgagcccggcgagcaccccgac
cacgtcatcgtcatcaagtatattccatacgttggggacagcaagagggccatggacgag
tacacctcggagatcttcatgggagggaagaacaccatcgtgctgcacaacacctgcgag
gactcgctcctcgccgcgcccatcatcctcgacctcgtcctcctcgccgagctcagcacc
aggatccagctcaaagctgaagaccaggataagtaccattctttccatccagtggctacc
atcctgagctacctcagcaaggctcctcttgttcccccaggcacaccagtggtgaatgca
ctggccaagcagagggccatgctggagaacatcctgagggcctgtgttggactggcccct
gagaacaacatgatgcttgagtacaagtga

DBGET integrated database retrieval system