KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331930
Entry
4331930           CDS       T01015                                 
Name
(RefSeq) aminotransferase ALD1 homolog
  KO
K10206  LL-diaminopimelate aminotransferase [EC:2.6.1.83]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    4331930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4331930
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.83  LL-diaminopimelate aminotransferase
     4331930
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4331930
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C KOW
Other DBs
NCBI-GeneID: 4331930
NCBI-ProteinID: XP_015630783
UniProt: Q6VMN7
LinkDB
Position
3:4936319..4941492
AA seq 440 aa
MPVNMISKLLEKAVLPALDVAPPVKIGGPRRTSVLRNPNMEKLQKGYLFPEISIKREEHL
KKYPDAKVISLGIGDTTEPIPSIVTSAMAEYALALSTPEGYQGYGPEQGHKNLRKEIADK
VYPDMGIKESEVFISDGAQCDIARLQTLFGPNVTIAVQDPTFPGYVDNGVIMGQTGKADD
GGRYAGIEYMRCAPENAFFPDLSRVRRTDVIFFCSPNNPTGHAASREQLRQLVELARRNG
SIIVFDSAYSSYISSSSSSSTPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWAVVPDE
LLYSDGVPVARDFDRVVCTCFNGASGIAQAGGVACLSTEEGRGAVARVVGVYRENARVLV
ETFRSLGKEVHGGGDAPYVWVRFPGRRSWDVFAEILEKTHVITVPGSGFGPGGEGFIRVS
AFNSRDKVLEACQRLKSFLA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcctgtcaatatgatctccaagttacttgagaaggctgttcttccagcactggatgtt
gcacctcctgtaaaaataggagggcctcggcgtacgagcgtgctgcgcaatccaaacatg
gagaagcttcagaaggggtacttattcccagagattagcatcaaacgtgaggaacacctg
aagaagtacccagatgcgaaggtgataagtttgggtatcggcgacacaactgaacccata
ccaagcatcgtaacatcagctatggctgagtatgctcttgcattgtcaactcctgaagga
taccaaggttatggaccagaacaaggccacaagaatctgaggaaggaaattgctgacaag
gtgtaccctgacatggggataaaagagagtgaagttttcatttcagacggagcacagtgt
gacattgctcgtcttcagacgctgttcggtccaaacgtcaccattgccgtccaagatccc
acatttccggggtacgtggacaatggcgtgatcatggggcagaccggcaaggcggacgac
ggcggcaggtacgccggcatcgagtacatgcggtgcgcgccggagaacgccttcttcccg
gacctgtcgcgggtgcggcggaccgacgtgatcttcttctgctcgcccaacaatccgacg
gggcacgcggcgtcgagggagcagctccggcagctggtggagctcgcgcggcggaacggc
tccatcatcgtcttcgactccgcctactcgtcctacatctcctcctcctcgtcgtcctcc
acgccgaggtccatctacgagatccccggcgcgagggaggtggcgatcgaggtgtcgtcc
ttctccaagttcgccgggttcacgggcgtccggctggggtgggctgtggtgcccgacgag
ctgctctactccgacggggtccccgtggcgcgggacttcgaccgcgtggtgtgcacgtgc
ttcaacggcgcgtcgggcatcgcgcaggcgggcggggtggcgtgcctgtcgacggaggaa
ggccgcggcgcagtggcgcgggtggtcggggtgtacagggagaacgcgcgggtgctggtg
gagacgttcaggtcgctggggaaggaggtgcacggcggcggcgacgcgccgtacgtgtgg
gtgaggttcccggggcggcggtcgtgggacgtgttcgcggagatcctggagaagacgcac
gtcatcaccgtgcctggcagcgggttcggccccggcggcgagggcttcatcagggtcagc
gccttcaacagcagggacaaggtcctcgaagcgtgccaacgcctcaaaagcttcctcgca
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332563
Entry
4332563           CDS       T01015                                 
Name
(RefSeq) probable LL-diaminopimelate aminotransferase, chloroplastic
  KO
K10206  LL-diaminopimelate aminotransferase [EC:2.6.1.83]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    4332563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332563
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.83  LL-diaminopimelate aminotransferase
     4332563
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4332563
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-GeneID: 4332563
NCBI-ProteinID: XP_015631441
UniProt: Q10MQ2
LinkDB
Position
3:10542837..10546179
AA seq 464 aa
MAASPAAGAAAATVSSFVSPSSFSSVKASKPDRLRPARRAAAVNVRCVSSPPATETSFKT
KVPRNANMAKLQAGYLFPEIARRRAAHLLKFPDAKIISLGIGDTTEPIPDVITNAMAKRA
HALSTVDGYSGYGAEQGEKKLRAAIAATYYADLGIEETDIFVSDGAKCDISRLQVLFGSN
VKIAVQDPSYPAYVDSSVIMGQTGLYQEDVQKYGNIEYMKCSPENGFFPDLSSVPRTDII
FFCSPNNPTGAAASRDQLTKLVKFAKDNGSIIVYDSAYAMYISDDSPKSIFEIPGAKEVA
IETASFSKYAGFTGVRLGWTVVPKELLFSDGHPVAKDFNRIVCTCFNGASNISQAGGLGC
LSPEGLKAMSDVVGFYKENTKIIVDTFTSLGFNVYGAKNAPYVWVHFPGRNSWDVFAEIL
EKAHVVTTPGSGFGPGGEGFVRVSAFGHRENIIEAARRLKQLYK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggccgcctcccccgccgccggggccgcggccgccaccgtctcgtcgttcgtctcgccg
tcgtccttctcctccgtcaaggcatcgaagcccgaccgcctccgtccggcgaggagggcg
gcggccgtcaacgtccgatgcgtcagcagccctccggccaccgaaacttctttcaagacg
aaagtaccacgaaatgccaatatggccaagctgcaagctggctatctgtttcctgagatt
gccaggagaagggcagctcacctgctgaagtttcctgatgcgaagattataagccttggg
atcggtgacactacagagcccattccagacgtcataactaatgccatggcaaagagagca
catgctttatccacagttgatggttatagtggttatggagctgaacagggtgaaaagaaa
ctaagggcagctattgctgcaacctactatgcggatcttggtattgaagaaacagatata
ttcgtctctgatggtgcaaaatgtgacatttctcgtctgcaggtcctttttggatctaat
gtgaagattgcagttcaagatccatcatatcctgcctatgttgattcaagtgttatcatg
gggcaaactggtttatatcaggaggatgttcagaagtatggaaatattgagtacatgaaa
tgcagtcctgaaaatgggtttttccctgatctgtcaagtgttccacgaacagatataatc
ttcttttgttcacccaacaatcctactggtgctgctgcatctcgggaccaattaaccaaa
ttagtcaaatttgcaaaggacaatggatccattatagtttatgattctgcttatgccatg
tacatatcagatgacagcccaaaatctatctttgaaattcctggagcaaaggaggttgcc
attgaaacagcatctttctccaaatatgctggattcactggtgtgcgtttgggttggact
gtggttcctaaggagctccttttctcagatgggcatcctgttgctaaagatttcaaccgc
atagtctgcacttgcttcaatggtgcatcaaacatttctcaagccggtggtttaggttgt
ctatctccagagggtctaaaggccatgagtgacgttgtcggcttctacaaggaaaatact
aaaattattgttgacacatttacatcacttggattcaacgtctacggtgccaagaatgct
ccatatgtgtgggtgcacttccctggccgtaattcttgggatgtcttcgccgaaattctt
gagaaggcacatgtggttactactcctggtagcggatttgggcccggtggtgaaggcttc
gtaagggtcagtgcatttgggcacagagagaacattattgaagctgcgagaagactgaag
cagctgtacaaatga

DBGET integrated database retrieval system