KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331942
Entry
4331942           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4331942 isoform X1
  KO
K02946  small subunit ribosomal protein S10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331942
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4331942
  Bacteria
    4331942
  Archaea
    4331942
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_11 BAAT_C FSH1 Peptidase_S9 Abhydrolase_2 Peptidase_S15
Other DBs
NCBI-GeneID: 4331942
NCBI-ProteinID: XP_015631060
LinkDB
Position
3:complement(5078242..5081734)
AA seq 361 aa
MAVSTSASSTLPLLSLHRAAGNPNPAALSFPPPLRAPPLRSRAAAAAASAAAPPAETIPD
MPEETEGTGIPMPSSIGDDGEQLLFGATAGKEIVTRPCSQLHSSLSDSSNVSQEKIVITN
RYGEKIVGLLHEAGSNDIVVLCHGFRSSKESRTILCLSDALTSENISVFRFDFTGNGESE
GTFQYGNYYKEVDDLRDVILHFKKHKRDTRGIAGHSKGGNVVILYSSIHRDVASIINMSG
RFDLRRGIADRLGSDYMEKIDRYGFIDVGVKTGRSIYRVTKESLMDRLKIDMKSACMSID
PKCRVLTIHGSDDDIVPSEDALEFDKYISNHELSIIEGADHRYSLHHLELATIVLKFIKY
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggccgtctccacctccgcctcctccaccctcccgctcctctccctccatcgcgccgcg
gggaaccccaacccggccgcactctccttcccgcctcccctccgcgcgcccccgctccgc
tcccgcgccgccgctgccgcggcctccgccgcagcaccgcccgccgagaccatccccgac
atgcccgaggagacggaggggacggggattccgatgccgtcgtcgattggggatgatggg
gagcagttactttttggtgctactgctggaaaagaaattgttacaaggccttgttcacaa
ttgcactcctcgttaagtgattcctccaatgtatcacaagagaaaatagtgataacaaac
agatatggagagaaaatcgttggtcttttgcatgaagctggatctaacgatattgtagtt
ttgtgccatggatttaggtcatcaaaggaaagtagaaccatactatgtctcagtgatgca
ctaacttcagaaaatattagcgtatttcgttttgatttcactggcaatggagaaagtgaa
ggcacattccagtatggcaactattacaaagaggtggatgatttgcgtgatgtaattcta
catttcaagaaacacaagcgtgacacccgcggtattgctggccacagtaaaggaggaaat
gtggtcatcctgtattcatccattcatcgagatgtagctagtattattaacatgtctgga
agatttgatctaagacgtggaattgctgatcgtcttggaagtgattatatggaaaagata
gaccggtatgggttcattgatgtgggagtgaaaacaggacgttccatctaccgtgtaacc
aaagaaagtctgatggatcgccttaagatagatatgaagagtgcatgcatgtctattgat
cctaaatgcagggttctgacaattcatggttctgatgatgatattgtgccatcagaggat
gccctagaatttgacaaatatataagcaatcatgaattgagtattattgaaggagctgat
catagatattcattgcatcaccttgagttggctaccattgtactgaaatttattaagtat
gagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352353
Entry
4352353           CDS       T01015                                 
Name
(RefSeq) ribosomal protein S10, mitochondrial
  KO
K02946  small subunit ribosomal protein S10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4352353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4352353
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4352353
  Bacteria
    4352353
  Archaea
    4352353
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-GeneID: 4352353
NCBI-ProteinID: XP_015618324
UniProt: A0A8J8XP91 Q9LRH5
LinkDB
Position
12:20105698..20107753
AA seq 112 aa
MAAKIRIVMKSFMSQANKVEGVIPYAQKVGLPESRSLYTVLRSPHIDKKSREQFSMHVKK
QFLVQKAETHELQKKLFWLKRLRLLGAQYELQISFKTRLDKKLLQAALSSGC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggccgccaagatacgcatagtgatgaaatcttttatgagccaagctaacaaagttgaa
ggggttattccatacgcgcagaaggttggattgcctgaatcacgatccttgtataccgtg
ctacgatcgcctcacatagacaagaagtcgagggagcagttctcgatgcatgtcaagaaa
caatttctggtacagaaggcggagacgcacgagctgcagaagaagctgttctggttgaag
cgcctgcgcctgcttggtgctcagtatgaactccagatcagtttcaagacccgtttggac
aagaagctgctccaagctgctttgtcgtcaggttgctag

DBGET integrated database retrieval system