KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332003
Entry
4332003           CDS       T01015                                 
Name
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4332003
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4332003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4332003
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4332003
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4332003
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  CK2 family
   4332003
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Kinase
    4332003
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 4332003
NCBI-ProteinID: XP_015628436
UniProt: Q10Q71 Q0DU49
LinkDB
Position
3:complement(5616045..5620722)
AA seq 332 aa
MSTARVYADVNVHRPREYWDYEALAVEWGEQDDYEVVRKVGRGKYSEVFEGINVTNDERC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLHNIVRDQQSKTPSLIFEYVNSTDFKVLY
PTLTDYDIRFYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYFPE
KEYNVRVASRYFKGPELLVDFQSYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDQLNAYLNKYRIALDPQLEALIGRHTRKPWSKFINPENRHLVSPEAIDFLDKLI
RFDHHDRLTAREAMAHPYFEQVRAAEDCRMRT
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcgacggcccgcgtctacgccgacgtgaacgtgcaccgccccagggagtactgggac
tacgaggccctcgccgtcgaatggggtgagcaggatgattacgaggttgtgcgaaaggta
ggcagagggaaatacagtgaagtcttcgaaggaattaatgtgacaaatgatgagcgctgc
atcattaaaattctcaagcctgttaagaaaaagaagataaagagggaaataaaaattctt
cagaacctctgtggtggtccaaatattgtcaaacttcacaatattgtcagagatcaacaa
tcaaaaactccaagtttgatatttgaatatgtaaacagcacagatttcaaagttctgtat
ccaacattgacagactatgatattcgattctacatttatgaacttcttaaggcattggat
tactgtcattctcaaggaattatgcaccgcgatgtcaagcctcacaatgttatgattgac
catgaactccgcaagcttcgcttaattgattggggacttgctgagttttattttccagag
aaagagtacaatgttcgggttgcctcaagatacttcaaagggcctgaattgctggttgac
ttccaaagttatgactactctttagacatgtggagccttggctgtatgtttgctggaatg
atatttcgcaaggaaccattcttctatggccacgataaccatgaccagcttgtcaaaata
gccaaggttctaggtacagaccagcttaatgcttacctgaataaatacaggattgcactt
gatccccagcttgaggctctgattgggaggcataccaggaaaccttggtctaagtttata
aatccagaaaataggcatcttgtctctccagaggctattgattttcttgataaacttatt
cgcttcgaccaccatgacaggctgaccgctcgtgaagctatggcgcatccctactttgaa
caagtgagggcagcagaagactgcagaatgagaacgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334206
Entry
4334206           CDS       T01015                                 
Name
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4334206
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4334206
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4334206
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4334206
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4334206
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  CK2 family
   4334206
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Kinase
    4334206
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 Kdo Choline_kinase RIO1 ArgoL2 TCAD9
Other DBs
NCBI-GeneID: 4334206
NCBI-ProteinID: XP_015628120
UniProt: Q8W5G9 A0A0P0W3E9
LinkDB
Position
3:31566056..31570464
AA seq 408 aa
MAWCAARSRLLPLATAPQLLRRLLLSSAAAPRYAHPHHHHSNSRRRRRPLAPTVYAAAAA
AAAEAPLPMPPRIGRATRHPGGAASVARVYADANSQRPKEYWDYESLDIEWGEQDGYEVL
RKLGRGKYSEVFEGFRPGGDERCVIKILKPVKKKKIKREIKILQNLYGGPNIVKLLDVVR
DDESKTPSLIFEYVNNTDFKVLYPTLLDYDIRYYIYELLKALDYCHSRGIMHRDVKPHNI
MIDHEKRQLCLIDWGLAEFYHPKMEYNARVASRSYKGPELLVDLLDYDYSLDLWSLGCMF
AAMIFRVDPFFNGQDNYDQLVKITEVLGTEDFYNYLEKYGLELDPQLERLVGRHNRKPWS
MFVNSGNRHLASPEAIDFVDRLLRYDHQERPTAKEAMAHPYFNPVRST
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcctggtgcgccgcgcgcagccgcctcctccccctcgccaccgcgccgcagctgctc
cgccgcctcctcctctcctccgctgcggccccgcgctacgcgcacccccaccaccaccac
agcaacagccgccgccgccgccgccccctcgcccccaccgtctacgccgctgccgcggca
gccgcagccgaggcgccgctccccatgccgccgcgcatcggccgcgccacgcggcacccc
gggggcgccgcctccgtggcgcgcgtctacgccgacgccaactcccagcggcccaaggag
tactgggactacgagtcgctcgacatcgaatggggggagcaggatgggtacgaggtgctg
cgcaagcttgggagggggaagtacagcgaggtgttcgagggattccggcccgggggtgac
gagaggtgcgttattaagatcctcaagcccgtcaagaagaaaaagataaagagggaaata
aagatacttcaaaacttatatggcggaccgaatattgtaaagctacttgatgttgtcagg
gatgatgaatcgaagacacctagtttgatctttgaatatgtcaacaatactgatttcaaa
gtactctacccaacactattggattacgatatcagatactacatttacgaattattaaag
gcactagattattgtcattcacgaggcatcatgcatcgagatgtcaaacctcacaatatc
atgattgatcatgagaaacgccagctttgtcttattgattggggtctagcagagttctat
catcccaagatggaatataatgctagagttgcttcaagatcttataagggccctgaactt
cttgtggatttgctagattatgattactcgttggatttgtggagccttggttgcatgttt
gccgcaatgatattccgagtcgaccctttctttaatggtcaggataactacgaccaatta
gtcaaaattaccgaggttcttggaacagaagatttctacaattaccttgaaaagtatggt
cttgagcttgacccgcagcttgaaagacttgttggaagacataataggaagccatggtca
atgtttgttaactcggggaacagacacctagcaagccctgaggctattgattttgtagac
aggttgcttcgctacgatcaccaggaaaggcctacagcaaaggaagccatggctcatcca
tatttcaatccagtgagaagcacttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342248
Entry
4342248           CDS       T01015                                 
Name
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4342248
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4342248
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4342248
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4342248
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4342248
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  CK2 family
   4342248
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Kinase
    4342248
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 Kdo
Other DBs
NCBI-GeneID: 4342248
NCBI-ProteinID: XP_015646887
UniProt: Q0D907 Q8H386
LinkDB
Position
7:complement(799529..805187)
AA seq 333 aa
MSKARVYTDVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY
PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDSLNSYLNKYRIELDPQLEALVGRHSRKPWSKFINADNQHLVSPEAIDFLDKLL
RYDHQDRLTAREAMAHPYFLQVRAAENSRPRAQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtccaaggccagggtctacaccgacgtcaacgtgctgcgccccaaggagtactgggac
tacgaggccctcaccgtccaatggggtgagcaggatgattatgaagttgtcaggaaagtt
gggagaggaaaatacagcgaggtctttgagggtattaatgtcaacaacaatgaaaaatgc
attatcaaaattctcaagcctgtgaagaaaaagaagatcaaaagagagataaaaatactt
cagaatctttgtggaggtccaaatatcgtgaaactgcttgatattgttagagatcagcac
tcaaaaacaccaagcttgatatttgaatatgtcaacaacacagatttcaaagtgctatac
ccaaccctgacagattatgacatccgttattatatctacgagctactgaaggctttagat
tactgccattcacaaggcatcatgcaccgcgatgtgaagcctcacaatgttatgatagat
cacgagcttcgaaaactccgattaatagactggggccttgctgaattctaccaccctggc
aaggaatataatgtccgtgttgcttcaaggtacttcaagggacctgagcttcttgttgac
ttgcaagattatgactactctttggacatgtggagtcttggttgcatgtttgctggaatg
atcttccgcaaggagccatttttctatggtcatgacaaccatgatcaacttgttaagatc
gcaaaggtacttgggacagacagcctgaattcatacttgaacaagtaccgtattgagctt
gacccacagcttgaagccctcgttggaaggcacagcaggaaaccttggtcaaagtttatt
aatgctgacaaccaacatctagtatccccagaggccatcgatttccttgacaagcttctt
cgctatgatcaccaggatagacttactgcacgtgaagctatggcacacccatactttctc
caagtgagggctgcggagaacagtaggcctcgtgcacaatag

DBGET integrated database retrieval system