KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332018
Entry
4332018           CDS       T01015                                 
Name
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4332018
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4332018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332018
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4332018
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     4332018
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4332018
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4332018
 Prokaryotic type
   Other AARSs
    4332018
SSDB
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_3 tRNA-synt_1e Anticodon_1 Fox-1_C tRNA-synt_1f
Other DBs
NCBI-GeneID: 4332018
NCBI-ProteinID: XP_015632755
UniProt: Q10Q53 B9F645
LinkDB
Position
3:5721100..5728600
AA seq 602 aa
MAAGRAFLRAAPSSLAAGAGRFAFACPTALPLTAAAAAATGPHRRGRGRCYCSASDAPPP
PPYVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLDKRVVFITGTDEHGEKIATSAEA
CGRNPKDHCDTISNSYKMLWADLDIEYDKFIRTTDRKHEAVVNDFYSRVLDSGDIYRADY
EGLYCVSCEEYKDEKELGENKCCPVHLKPCVPRKEDNYFFALSKYQHQLEDLLTKNPNFV
RPSHRLNEVQGWVKSGLRDFSISRASVEWGIPVPNDTKQTIYVWFDALLGYISALLDDGE
KASLQQAVERGWPASLHLIGKDILRFHAVYWPAMLMSAGISVPDAVFGHGFLTKDGMKMG
KSLGNTLEPKDLVNRFGVDSVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLLNR
TLGLLKKNCKSTLAFDSIAAADGISLKDNVENLVDKAKDQFENLLLSSACETLMEIGNLG
NLYIDEQAPWSCFKQGGESAEKAAKDLVIILETMRIIAIALSPITPSLSLRIYTQLGFTE
DQFRTLRWEDTKWGGLKAGQVMMEPKPVFARIETETDEKDQSSSKATKGGKKKARSQGLV
EA
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggccgccgggcgggccttcctccgcgccgccccctcctcgctggccgccggcgccgga
cgcttcgccttcgcgtgcccgacggcccttcccctcactgccgccgccgcggcggcgacc
gggccacaccgtcgcggccgcggccgatgctactgctccgcctccgatgcgccgccgccg
ccgccatacgtgctcaccacgccgctctactacgtcaacgccccgccgcacatggggagc
gcctacaccaccattgccgccgacgccatcgcccgcttccagaggttgctggataagagg
gtcgtatttattaccggaacagatgagcatggcgagaaaattgccacttcagcagaggct
tgtggtagaaacccaaaggatcattgtgatacaatttccaattcatataagatgctttgg
gctgatctagacatagagtatgacaagtttatccgcacaactgatcgtaagcatgaggca
gttgtcaatgacttctattccagagtgctagatagtggtgacatatatagagcagattat
gaaggactttactgtgtgagctgtgaggagtacaaggacgaaaaagagcttggggaaaac
aaatgttgcccagtgcatctaaagccttgtgtaccaagaaaggaagacaactatttcttt
gccttgtcaaaataccagcatcaactggaagatctactgacaaaaaatcctaattttgta
cggccatcacatcgcttgaatgaggtccaaggatgggttaaaagtggattaagggacttc
tctatttcccgtgcatctgtagagtggggtattccggtgccaaatgacaccaaacagaca
atatacgtgtggtttgatgcattattagggtacatttcagcattactagatgatggggag
aaggcaagtttacaacaagcagttgaacgtggttggcctgcctccctacacttgatagga
aaggacatattgcggtttcatgcagtatattggccagcaatgttaatgtcagcaggaata
agtgttcctgatgcagtttttggtcatggatttttgacaaaggatggcatgaagatggga
aaatcattaggcaacacacttgaaccaaaggatctggtaaacagatttggagtagactct
gttaggtacttcttcttgcgggaagtggaatttggcaatgacggggactattcagaggaa
cgctttatcaatatagtcaatgcgcatcttgccaacaccattggaaacctcctcaatcgc
acacttgggctgctaaagaagaattgtaaatccacattagcttttgactcgattgctgcc
gcagatggaatttcattaaaggataatgttgaaaacttggtggacaaggcaaaggatcag
tttgaaaatcttttgctgtcatcagcatgtgaaactcttatggagattggtaacttagga
aacttgtacattgatgagcaagcaccatggtcttgtttcaagcaagggggtgagagtgct
gaaaaggcagcgaaggatcttgttattattttggagactatgagaataattgcaattgca
ctatcaccgatcaccccaagcctttctttgaggatttatacacagcttggtttcacagaa
gaccaatttagaacattgagatgggaggataccaaatggggaggtctaaaggcaggtcag
gtaatgatggagccaaagccagtttttgcaaggatagaaacagagacggacgagaaagat
caatcaagttcgaaggcaacaaaaggcgggaagaagaaggcaagaagtcaaggacttgtg
gaagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341140
Entry
4341140           CDS       T01015                                 
Name
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4341140
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4341140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4341140
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4341140
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     4341140
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4341140
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4341140
 Prokaryotic type
   Other AARSs
    4341140
SSDB
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_3 tRNA-synt_1 Anticodon_1 tRNA-synt_1e CoV_peptidase
Other DBs
NCBI-GeneID: 4341140
NCBI-ProteinID: XP_015643979
UniProt: Q9ZTS1 B9FTH9
LinkDB
Position
6:complement(18145649..18154574)
AA seq 801 aa
MASPPPPPKLPVPGRRNILVTSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNVIYI
CGTDEYGTATETKAMEEKCSPKEICDKYHAVHSEVYKWFDIKFDKFGRTSSPQQTEVCQA
IFQKLMENNWLTENTMQQLYCDTCQRFLADRLVEGKCPTEGCNYEAARGDQCENCSKLLN
PTELIDPKCKVCKNTPRVRDTDHLFLELPLLSDKLVNYINETSVAGMWSQNAIQATNAWL
KEGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITASYTPDWEKWWKDPDNV
ELFQFMGKDNVPFHTVMFPSTLLGTGEKWTMMKTISVTEYLNYEAGKFSKSHGIGVFGND
AKDTNIPPEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFVAKPAG
AGYDSIVPDAPNAESHPLTKALVEKTNKWVEQYLEAMEKVKLKQGLKSAMGISSDGNAYL
QESQFWKLYKEDPAACAVVMKTSVGVVYLLACLLEPFMPSFSNEVLLQLNMTPEESLSFC
DDKGEIAKAKRPWDFVSAGHKIGKPSPLFKELKDEEVESFRNKFAGSQAERSSKAQADAE
AKKVADKLKGTKLSDGGQKKEQKKQSGGSKSKNAEVDVTVAKLDIRVGLIRKAQKHPDAD
SLYVEEIDVGEEAPRTVVSGLVKFIPLEEMQNRKVCVLCNLKPVAMRGIKSHAMVLAASN
EDHTKVELVEPPESAAVGERVTFAGYSGEPEASLNAKSKTWEKLSADLHSNGELVACYKD
VPFTTSAGVCKVKSIASGEIR
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggcgtcgccgccgccgcctccgaagctgccggtccccggccgccgcaacatcctcgtc
accagcgcgctgccctacgtcaacaacgtccctcacctcgggaacatcatcggctgcgtg
ctcagcgccgacgtgttcgcgcgctactgccggctgcggggctacaacgtcatctacata
tgcggcaccgacgagtacgggacggccaccgagaccaaggccatggaggagaagtgctcg
cccaaggagatctgcgacaagtatcatgctgtccatagtgaggtttacaaatggtttgac
ataaagtttgacaagtttggacggacatcctctccccaacagactgaagtctgccaagca
attttccaaaagttgatggaaaacaattggctcacagaaaacaccatgcagcagctgtac
tgtgatacttgccaacgatttttagcggataggctcgtggaggggaaatgtccaactgaa
ggctgtaattatgaggcggcgcgaggtgatcagtgtgaaaactgcagcaaattgttgaat
ccaactgagctaattgatcccaagtgtaaggtctgtaagaatactccacgtgtccgtgac
acagatcacttattccttgagcttcctcttttgagcgacaagttggtaaactatatcaat
gaaacttctgtagctggtatgtggagtcaaaatgctattcaggcaacaaacgcatggctg
aaggaaggtttgaagccacgctgtatcacccgagatctcaagtggggtgttcctgttcca
catgagaaatataaggacaaggtgttctatgtttggtttgatgcaccgattggctatgta
tctatcacagcttcctatacacctgattgggagaaatggtggaaggatcctgataacgta
gaattgtttcagttcatgggtaaagataatgtgccatttcacacggtcatgttcccttct
acattacttggaactggcgaaaagtggacaatgatgaagaccataagtgtgactgaatat
ttgaactacgaagcaggaaaattctccaagagccatggtattggagtctttggtaatgac
gcgaaggatacaaatatacctcctgaagtgtggcgttactacttgcttacaaatcgtcct
gaggtatcagatacactatttacttgggctgatttgcaagccaaattaaacagtgagttg
ttgaacaacttggggaatttcatcaaccgtgtgctcagttttgttgcaaaaccagcagga
gccggatatgattccatcgtacctgatgctcctaacgctgagtcgcatccactgacaaag
gcacttgttgagaaaactaataaatgggttgaacaatatcttgaagcaatggaaaaggtt
aaattgaaacaaggactgaagagcgctatgggcatttctagtgatggaaatgcatatctg
caagagagccagttttggaaactttataaggaagatccagcagcctgtgctgttgtaatg
aaaacttcagttggtgtggtctatctccttgcctgtttgctggagcctttcatgccttca
ttttccaatgaagtgttgctgcaattaaatatgacccctgaagaaagcttgtctttctgt
gacgataaaggagaaatcgccaaggcaaaaagaccttgggattttgtatcagcaggccac
aaaataggaaagccttcacctctatttaaagaactgaaagatgaagaagtagagtccttc
aggaataaatttgcaggcagccaagctgagaggagctcaaaagcacaagctgatgctgaa
gctaagaaggttgctgacaagctcaagggcacaaaattatctgatggaggtcaaaagaag
gaacagaaaaaacaatcaggtggttcaaaatcaaagaatgcagaggtggatgtcacggtg
gcaaagttggatattcgagtggggcttatcaggaaagcacagaagcatccagatgctgat
tcgctgtatgtagaggagattgatgttggagaggaagcaccaagaacagttgttagcggc
cttgtcaaattcatccctcttgaagaaatgcagaaccggaaagtgtgtgttctctgcaat
ctgaaaccagtggcgatgcgcggtataaaatcacatgcaatggttctggctgcatcaaat
gaggaccatacaaaggttgagctggttgagccaccagaatccgcagcggttggggagagg
gtgacctttgctgggtactctggagagcctgaggcgtctctcaacgcaaagagcaagacg
tgggagaagctatcagctgacctgcacagcaacggcgagctcgtggcgtgctacaaggat
gtacccttcacaacttcagctggagtttgcaaggtgaagtcgatagcgagtggagaaatt
cgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348562
Entry
4348562           CDS       T01015                                 
Name
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4348562
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4348562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348562
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4348562
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     4348562
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4348562
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4348562
 Prokaryotic type
   Other AARSs
    4348562
SSDB
Motif
Pfam: tRNA-synt_1g Anticodon_3 tRNA-synt_1 Anticodon_1
Other DBs
NCBI-GeneID: 4348562
NCBI-ProteinID: XP_015614158
UniProt: Q338J4 B9G5L8
LinkDB
Position
10:13492779..13496776
AA seq 605 aa
MAAAKEAVVPVEGRRNVLVTSALPYVNNVPHLGNIIGCVLSADAFARYCRLRGHNVLYVC
GTDEYGTATETKAMEEGCSPREICDKYHAIHKEVYEWFDISFDIFGRTSSPQQTEVCQDI
FLKLLDNNWLSENTMQQLYCNSCQRFLADRLVEGYCPTEGCNYDSARGDQCEKCGKLLNS
TELVNPKCKVCGSTPCVRDTDHLFLELPLLREKLEKYIDETSLTGSWSQNAIHATNAWLK
EGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYISITACYTPEWEKWWKNPENVE
LYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYESGKFSKTKGIGVFGNDA
KSTNIPPEVWRYYLLTNRPEASDTLFTWTDLQAKCNNELLNNLGNFINRVLSFIAKPEGT
GYGSVVPDSPDVDSHALTQSLAETVGKLIDQYIDAMDKVKIKQGLKIAMAISSEGNAYLQ
ESQFWKLYKQDPASCATVMKTSVGIVYLLACLLEPFMPTFSKDVLQQLNLSPEEHLSFCD
EKGEVEKAKRPWDLIPSGHRIGKPAPLFKGLENEAVKGLREKFAGSQAERKLRTQVAAQL
EATSI
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcggcggcgaaggaggcggtggtgccggtggaggggcggaggaacgtgctggtgacg
agcgcgctgccgtacgtgaacaacgtgccgcacctggggaacatcatcggctgcgtgctc
tccgccgacgccttcgcgcgctactgccgcctccgggggcacaacgtgctctacgtctgc
ggcaccgacgagtacggcaccgccaccgagaccaaggccatggaggaaggctgctccccc
agggagatctgcgacaagtaccatgccatccacaaggaagtgtacgagtggttcgacatc
agcttcgacatcttcggtagaacatcgtcgccgcaacagaccgaggtctgccaagacatc
ttcctcaagctactggacaacaattggctgtcagagaacacaatgcagcagctttactgc
aattcatgccaaaggttcttggctgacaggcttgtggagggctactgccccacagaggga
tgcaactatgactctgccaggggtgaccaatgcgagaagtgtggaaaattgctgaattca
actgagctggttaatcccaagtgcaaggtttgcgggagcacgccttgtgtccgcgacacg
gatcacttgttcttggagctccctctgctgagggagaaacttgagaagtatatcgacgag
acttctttgactggatcatggagccaaaacgctattcatgcaacaaatgcttggttgaag
gaagggttgaagcctcgctgcattaccagggatctgaaatggggtgtgcctgtcccacat
gagaagtacaaagacaaggtgttctatgtctggtttgatgcaccaatcgggtacatctcc
attacggcgtgctacacgcctgagtgggagaaatggtggaagaatccagaaaatgttgaa
ttgtatcagttcatgggtaaagacaatgtcccattccatacggtcatgttcccctccaca
ctacttggaactggagaaaattggactctgatgaagacgattagtgtgacagagtatctc
aattatgaatcaggaaagttctccaaaacaaagggcattggagtgtttgggaatgatgca
aaatccacaaatattcctcctgaagtgtggcgatactacttgcttaccaatcgtcccgag
gcatcagatacattgttcacttggacagatttgcaagccaagtgtaacaacgagctgctg
aacaatttagggaacttcatcaatcgagtactaagctttatcgcgaaaccagagggaact
ggatatggttctgttgtacctgattctcctgatgtggattcccatgctctgactcagtca
ttggctgagactgttggtaaattgattgatcagtacatcgatgcaatggacaaggtcaaa
ataaaacaagggctgaagattgcaatggccatttctagcgaaggaaatgcatacctacaa
gagagtcagttttggaagctttacaaacaagatccagccagttgcgcaactgtgatgaaa
acctcagttggaattgtgtacctcctggcatgtttgctggagcctttcatgccaacattc
tcaaaagatgttctgcagcagctaaatctaagtccagaagagcacctatcattttgtgat
gaaaaaggagaggttgagaaggccaaaagaccttgggatctcataccatcaggccacagg
atagggaaacctgcacctttgttcaagggattggaaaacgaagcggtgaagggcttgaga
gaaaaatttgcaggcagccaagctgaaagaaaattgaggactcaagtcgccgcacaattg
gaagccacaagcatatag

DBGET integrated database retrieval system