KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332052
Entry
4332052           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4332052
   03420 Nucleotide excision repair
    4332052
   03430 Mismatch repair
    4332052
   03440 Homologous recombination
    4332052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4332052
   03032 DNA replication proteins [BR:osa03032]
    4332052
   03400 DNA repair and recombination proteins [BR:osa03400]
    4332052
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4332052
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4332052
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4332052
   MMR (mismatch excision repair)
     4332052
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4332052
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon DUF223 BRCA-2_OB3
Other DBs
NCBI-GeneID: 4332052
NCBI-ProteinID: XP_015628911
UniProt: Q10Q08
LinkDB
Position
3:5979571..5983095
AA seq 630 aa
MDSDAAPSVTPGAVAFVLENASPDAATGVPVPEIVLQVVDLKPIGTRFTFLASDGKDKIK
TMLLTQLAPEVRSGNIQNLGVIRVLDYTCNTIGEKQEKVLIITKLEVVFKALDSEIKCEA
EKQEEKPAILLSPKEESVVLSKPTNAPPLPPVVLKPKQEVKSASQIVNEQRGNAAPAARL
AMTRRVHPLISLNPYQGNWIIKVRVTSKGNLRTYKNARGEGCVFNVELTDVDGTQIQATM
FNEAAKKFYPMFELGKVYYISKGSLRVANKQFKTVHNDYEMTLNENAVVEEAEGETFIPQ
IQYNFVKIDQLGPYVGGRELVDVIGVVQSVSPTLSVRRKIDNETIPKRDIVVADDSSKTV
TISLWNDLATTTGQELLDMVDSAPIIAIKSLKVSDFQGLSLSTVGRSTIVVNPDLPEAEQ
LRAWYDSEGKGTSMASIGSDMGASRVGGARSMYSDRVFLSHITSDPNLGQDKPVFFSLNA
YISLIKPDQTMWYRACKTCNKKVTEAIGSGYWCEGCQKNDAECSLRYIMVIKVSDPTGEA
WLSLFNDQAERIVGCSADELDRIRKEEGDDSYLLKLKEATWVPHLFRVSVTQNEYMNEKR
QRITVRSEAPVDHAAEAKYMLEEIAKLTGC
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggattccgacgcggcaccgtcagtgacgccgggggcggtggcgttcgtcctggagaac
gcgtcgccggacgcggccaccggcgtgccggtgccggagatcgtcctccaggtcgtcgac
ctcaagcccatcggcacccgcttcactttcttggcgagcgatggcaaggacaagataaag
acgatgcttctcacccagctcgctccggaggtgcgctccggcaacatccagaatctcggc
gtcatccgcgtcctcgactacacctgcaacaccatcggcgaaaagcaggaaaaggtcttg
attatcacgaagctcgaggtcgtgttcaaggcgctggattccgagatcaagtgcgaggcc
gaaaagcaagaggagaagccggcgattctgttgagtcccaaggaggaatccgtggttctc
tccaagcccacgaacgcgccgccacttcctccggttgtgctgaagcccaagcaggaggtg
aagtccgcgtcccagatcgtgaacgagcagcgcggcaatgctgctcctgcggcgcggttg
gccatgacgagaagagttcatcctttgatctccctgaacccctaccagggcaactggatc
atcaaggtgcgtgtcacaagcaagggcaacctgaggacgtacaagaatgctcgtggtgaa
ggctgcgtcttcaatgtggagctcactgatgtggatggcacccagatccaggcaaccatg
ttcaacgaggctgccaagaagttctatccgatgtttgagctggggaaggtgtactacatc
tccaaaggatctctcagagtcgccaacaagcagttcaagactgtccataatgactacgag
atgaccctgaatgagaatgctgttgttgaggaagctgagggcgaaacttttatcccacag
attcagtacaactttgtcaagattgatcagctagggccatatgttggtggcagggagcta
gtagatgttattggggttgttcagagcgtatctcctactcttagtgttaggaggaagatt
gacaacgagacgattccaaagcgtgacatcgttgtagcggatgactcgagcaaaactgta
accatatctctttggaatgatcttgccacaactactggtcaggagctcttggacatggta
gactctgcgcctatcattgcgataaagagcctaaaagtatctgacttccaaggtttgtct
ctgtcaactgtggggagaagtacaattgtagtgaatcctgacttgcctgaggcagaacag
ctcagagcttggtatgactctgaaggcaagggtacttcaatggcatcaattggttcagat
atgggcgcatcaagggttggtggcgcgagatccatgtacagtgatagagtttttctgtct
cacatcacaagtgaccccaacttgggtcaggataagcctgtgttcttcagtctgaatgcc
tatattagccttatcaagcctgaccaaaccatgtggtaccgagcttgcaagacctgcaac
aagaaggtgactgaggcaattggatcaggatactggtgtgaagggtgccagaagaatgat
gctgagtgctcactgaggtacatcatggtcatcaaggtctccgaccctactggtgaggcc
tggctttctctgttcaatgatcaggcagagaggattgttggctgcagtgcagatgagctt
gatcggattaggaaggaggagggtgatgacagttaccttctcaagctgaaggaagctact
tgggttcctcacctgttccgcgtcagcgtaactcagaatgagtacatgaatgagaagagg
cagaggatcactgtgaggagtgaagctccggtagaccacgcagctgaagccaagtacatg
ctcgaggagatagccaagctgacaggttgctag

DBGET integrated database retrieval system