KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332082
Entry
4332082           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn] 2 isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4332082
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4332082
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 4332082
NCBI-ProteinID: XP_015631402
UniProt: Q10PW4
LinkDB
Position
3:complement(6271956..6275398)
AA seq 164 aa
MAGKAGGLKGVALIGGAGGNSAVAGALHFFQDPSTGYTEVRGRVTGLAPGLHGFHIHSFG
DTTNGCNSTGPHFNPHNKSHGAPSDDERHVGDLGNIVANKDGVADIFIKDLQISLSGPHS
ILGRAVVVHADSDDLGRGGHELSKTTGNAGARIGCGIIGLRSAV
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcagggaaagccggcggcctcaagggcgtcgccctcatcggcggcgccggcggcaac
agcgcggtcgccggcgccctccacttcttccaggacccctccaccgggtataccgaggtg
agggggagggtcaccggcctcgctccgggcctccatggcttccacatccactcctttggc
gacaccaccaacggctgcaactctaccgggccccattttaatcctcacaataagtcccat
ggggcaccatctgatgatgaaagacatgtgggcgacctgggaaacatagtagccaacaaa
gatggtgttgcagatatcttcataaaggacctacagatttcactaagcgggcctcattcc
atattgggaagggcagttgttgttcatgctgattctgatgacctaggaaggggtggtcat
gaactcagtaaaacaacaggaaatgcaggagcaagaattggatgcggtatcattggactt
cgatctgcagtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332846
Entry
4332846           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn] 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4332846
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4332846
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 4332846
NCBI-ProteinID: XP_015632608
UniProt: Q0DRV6
LinkDB
Position
3:13181327..13184512
AA seq 152 aa
MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTG
PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt   +upstreamnt  +downstreamnt
atggtgaaggctgttgttgtgcttggtagcagtgagattgttaagggcactatccacttt
gtccaagagggagatggtcccaccactgtgactggaagtgtctctggcctcaagcctggt
ctccatgggttccatattcatgcacttggtgacaccaccaatggttgcatgtcaactggg
ccacactacaatcctgccggaaaggagcatggagcaccagaagatgagacccgccatgct
ggtgatcttggaaatgtcaccgctggagaagatggtgttgctaatatccatgttgttgac
agtcagattccacttactggaccaaattcaatcattggcagagccgtcgttgtgcatgcc
gatcctgatgatcttggaaagggtgggcacgagctgagcaagaccaccggaaacgctggt
ggccgtgttgcttgcgggatcatcggacttcaaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338417
Entry
4338417           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4338417
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4338417
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N PSII_Pbs31 DUF1965
Other DBs
NCBI-GeneID: 4338417
NCBI-ProteinID: XP_015640127
UniProt: Q43008
LinkDB
Position
5:15046735..15051400
AA seq 231 aa
MALRTLASRKTLAAAALPLAAAAAARGVTTVALPDLPYDYGALEPAISGEIMRLHHQKHH
ATYVANYNKALEQLDAAVAKGDAPAIVHLQSAIKFNGGGHVNHSIFWNNLKPISEGGGDP
PHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVT
KGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYENATA
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgctccgcacgctggcctcgaggaaaaccctagccgccgcggcgctgccgctggct
gcggcggcggcggcgaggggtgtgacgaccgtcgcgctcccggacctcccctacgactac
ggcgcgctggagccggccatctccggggagatcatgcgcctgcaccaccagaagcaccac
gccacctacgtcgccaactacaacaaggccctcgagcagctcgacgccgccgtcgccaag
ggcgacgcccccgccatcgtgcacctccagagcgccatcaagttcaacggcggaggccat
gtcaatcattcgatcttctggaataacctcaagcctatcagcgagggtggtggtgatcca
ccacatgcaaaacttggctgggccattgatgaggattttggttcatttgaggcacttgta
aagaagatgagtgcagaaggtgctgctttacaaggatctggatgggtgtggctagctttg
gataaagaggcaaagaagctttcagtggaaacaactgctaaccaggaccctctggtaacg
aagggggccaacttggttcctttgttgggaattgatgtctgggagcatgcgtactacctg
cagtacaagaatgtcaggccagactacctgagcaacatctggaaggtgatgaactggaaa
tacgcaggggaggtgtacgaaaatgcgactgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339922
Entry
4339922           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Fe] 1, chloroplastic
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4339922
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4339922
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 4339922
NCBI-ProteinID: XP_015641241
UniProt: Q5VRL3
LinkDB
Position
6:complement(864354..866968)
AA seq 391 aa
MAFATLVGVGGLSPALFSPSRPLSCSSSTSVSAPFILRAGGGGDARRHGLRRLVTPLRGS
ACRGESTNSRVLQCANEANVVTEDDIVNDGIDDETASDAEMDEDAEANGDESSGTDEDAS
VSWIEQQPLPYPSDALEPYISKETVEQHWGVHQNIHVERLNGMIGGSEWEGMSLGQMMLS
SFNEGREAPHPPFFHAAQIWNHDFYWRSMQPGGGGKPPERLLKFINRDFGSYDGMIRQFM
DAASTQFGSGWVWLCYKTSKLPHVKSRSPIPSDNYGRLVISKSPNAINPLVWGHSPLLAI
DLWEHAYYLDYEDRRSDYVSTFLEKLVSWETVESRLKKAVQRAVERDEYVSTKHIRKQLL
ARAKSQIRAMPQQVNGDAREQTSGQEKSLGV
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcgttcgccacactggtgggagtgggaggcctatcgcctgccctcttctccccctcc
cgccccctctcctgctccagctccacctccgtctcggccccgttcatcctccgcgccggc
ggcggcggcgacgcccggcggcatggcctccgacgcctcgtcaccccactgagagggagc
gcctgcaggggagagagtacgaactcacgtgtactccagtgtgccaatgaggctaatgtg
gtgaccgaggatgacattgtgaacgatggtatcgatgatgaaaccgcttccgatgctgaa
atggatgaggatgctgaagcaaatggtgatgagtcgtcaggcactgatgaagatgcttct
gtctcctggatagagcagcagcctcttccttatccttcagatgccctagagccatacatc
agcaaggagacggtggaacagcactggggagttcatcagaacattcacgtcgagaggctc
aatggcatgattggtggcagtgagtgggaggggatgtcgctggggcagatgatgctatcc
tccttcaatgagggcagggaggcaccccatccccccttcttccatgctgcacagatatgg
aaccatgatttctattggcgatctatgcaacctggtggcgggggaaaacccccagaacgc
cttttgaaatttatcaacagggactttggatcctatgatggcatgattcgacaatttatg
gatgctgcatcaactcaatttggttctggatgggtttggctttgttacaaaacaagcaag
ttgcctcatgtgaaatcaagaagcccaatcccatctgataattatggtagactggtcatc
tcaaagtctccgaatgccatcaatcctcttgtctggggtcactctccactccttgcaatt
gatctttgggagcatgcatactacctggattatgaggatcggagatctgactatgtctcc
acatttctagagaagcttgtgtcatgggaaactgttgagtccaggcttaagaaggccgta
caacgggcagtagaaagagatgaatatgttagcacaaagcatataaggaagcaactttta
gctcgggcaaagagccaaatcagagctatgcctcagcaggtcaatggggatgcaagagag
cagaccagcggtcaagagaagtccctaggggtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340091
Entry
4340091           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Fe] 2, chloroplastic
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340091
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4340091
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF6725
Other DBs
NCBI-GeneID: 4340091
NCBI-ProteinID: XP_015642495
UniProt: Q5VSB7
LinkDB
Position
6:2256832..2262156
AA seq 255 aa
MAAFASALRVLPSPPAAVPRRLRSREQRQGCRSRRYSKVVAYYALTTPPYKLDALEPYIS
KRTVELHWGKHQQDYVDSLNKQLATSMFYGYTLEELIKEAYNNGNPLPEYNNAAQVWNHH
FFWESMQPEGGGSPGRGVLQQIEKDFGSFTNFREEFIRSALSLLGSGWVWLVLKRKERKF
SVVHTQNAISPLALGDIPLINLDLWEHAYYLDYKDDRRMYVTNFIDHLVSWDTVTLRMMR
AEAFVNLGEPNIPVA
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcggctttcgcctccgctctccgcgttctcccctcgccgccggctgcggtgcctcgt
cggcttcgctcgagagaacaaaggcagggctgtagatctcgaaggtattcaaaagtcgtg
gcttactacgctctcactactccgccgtataaacttgatgccctggaaccttatattagc
aagaggacagttgaacttcactggggtaagcatcagcaagactatgtggatagcttgaat
aagcagcttgctaccagcatgttctatgggtacactctggaggaactaataaaagaagca
tacaacaacggcaacccattaccagaatataataatgcagcacaggtatggaaccatcac
ttcttctgggaatcaatgcagccagaaggtggtgggtcaccagggcgaggtgtcctgcag
cagatagagaaggattttggctcttttactaattttagggaagagtttatacgctcagca
ttatcacttttggggtctggctgggtttggcttgtcttgaagagaaaagaacgaaaattt
tcggtagtccatacacaaaatgccatcagtccacttgcacttggtgatattccactcatc
aatctagacttgtgggagcatgcttactacttggattacaaggatgacaggcgaatgtat
gttacaaactttatcgaccatcttgtctcttgggatactgtcactctacgcatgatgcgc
gctgaggcttttgtgaaccttggtgaaccaaatatcccagttgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344210
Entry
4344210           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn] 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4344210
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4344210
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 4344210
NCBI-ProteinID: XP_015647771
UniProt: P28757
LinkDB
Position
7:complement(28075581..28077669)
AA seq 152 aa
MVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt   +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtgcttgctagcagtgagggtgtcaagggcaccatctttttc
tcccaagagggagatggtccgacctctgtgacgggaagtgtctctgggctcaagccaggg
ctccatggattccatgtgcacgcgctcggtgacaccactaatggctgcatgtcaactgga
ccacacttcaatcctactgggaaggaacatggggcaccacaagatgagaaccgccatgcc
ggtgatcttggaaatataacagctggagcagatggtgttgctaatgtcaatgtctctgac
agccagatcccccttactggagcacactccatcattggccgagctgttgttgtccatgct
gatcctgatgatcttggcaagggtggacatgagcttagcaagaccactggaaatgctggg
ggccgagttgcttgcggaatcatcggactccagggttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346329
Entry
4346329           CDS       T01015                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4346329
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4346329
SSDB
Motif
Pfam: Sod_Cu SEEK1
Other DBs
NCBI-GeneID: 4346329
NCBI-ProteinID: XP_015649518
UniProt: P93407
LinkDB
Position
8:28132342..28135506
AA seq 211 aa
MQAILAAAMAAQTLLFSATAPPASLFQSPSSARPFHSLRLAAGPAGAAAARALVVADATK
KAVAVLKGTSQVEGVVTLTQDDQGPTTVNVRVTGLTPGLHGFHLHEFGDTTNGCISTGPH
FNPNNLTHGAPEDEVRHAGDLGNIVANAEGVAEATIVDKQIPLSGPNSVVGRAFVVHELE
DDLGKGGHELSLSTGNAGGRLACGVVGLTPL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaagccatcctcgccgctgccatggccgcccagaccctcttgttctccgccaccgcc
cctcccgcctcccttttccagtccccttcctctgcccgccctttccactcgctccgcctc
gccgccggccccgcgggcgccgccgctgccagggcgctcgtcgtcgccgacgccaccaag
aaggccgtcgccgtgctcaagggcacctcccaggttgagggagtcgtcaccctcacccag
gatgaccaaggtcctacaacagtgaatgtccgtgtgacgggacttactcctggacttcac
ggcttccacctccacgagtttggcgatactacgaatgggtgcatatcaacaggaccacat
tttaacccaaacaatttgacgcacggtgcaccagaagatgaagtccgtcatgcgggtgac
ctgggaaacattgttgccaatgctgaaggtgtagctgaggcaaccattgttgataagcag
attcctctgagtggcccaaattctgttgttgggagagcattcgttgttcatgagcttgaa
gatgatttggggaagggtggccatgagcttagtctcagtactggaaatgctggtgggcga
cttgcatgcggtgttgttgggctgaccccgttgtag

DBGET integrated database retrieval system