KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332134
Entry
4332134           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 90B1
  KO
K09587  steroid 22S-hydroxylase [EC:1.14.14.178]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4332134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4332134
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.178  steroid 22S-hydroxylase
     4332134
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP90 family
   4332134
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4332134
NCBI-ProteinID: XP_015633105
UniProt: Q5CCK3
LinkDB
Position
3:6737488..6744509
AA seq 506 aa
MAAMMASITSELLFFLPFILLALLTFYTTTVAKCHGGHWWRGGTTPAKRKRMNLPPGAAG
WPLVGETFGYLRAHPATSVGRFMEQHIARYGKIYRSSLFGERTVVSADAGLNRYILQNEG
RLFECSYPRSIGGILGKWSMLVLVGDPHREMRAISLNFLSSVRLRAVLLPEVERHTLLVL
RAWPPSSTFSAQHQAKKFTFNLMAKNIMSMDPGEEETERLRREYITFMKGVVSAPLNLPG
TPYWKALKSRAAILGVIERKMEERVEKLSKEDASVEQDDLLGWALKQSNLSKEQILDLLL
SLLFAGHETSSMALALAIFFLEGCPKAVQELREEHLGIARRQRLRGECKLSWEDYKEMVF
TQCVINETLRLGNVVRFLHRKVIKDVHYKGYDIPSGWKILPVLAAVHLDSSLYEDPQRFN
PWRWKSSGSSGGLAQSSSFMPYGGGTRLCAGSELAKLEMAVFLHHLVLNFRWELAEPDQA
FVFPFVDFPKGLPIRVHRIAQDDEQE
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggccgccatgatggcgtccataaccagcgagctgctcttctttctccccttcatcctc
cttgccctgctcacgttctacaccaccaccgtggccaaatgccacggcgggcactggtgg
cgaggtgggacgacgccggcgaagaggaagcggatgaacctgccgcccggcgccgccggg
tggccgctcgtcggcgagacgttcggctacctccgcgcccaccccgccacctccgtcggc
cgcttcatggagcagcacatcgcacggtacgggaagatataccggtcgagcctgttcggg
gagcggacggtggtgtcggcggacgcggggctcaaccggtacatcctgcagaacgagggg
aggctgttcgagtgcagctacccgcgcagcatcggcggcatcctgggcaagtggtccatg
ctggtcctcgtcggggacccgcaccgcgagatgcgcgccatctccctcaacttcctctcc
tccgtccgcctccgcgccgtcctcctccccgaggtcgagcgccacaccctcctcgtcctc
cgcgcctggcccccttcctccaccttctccgctcagcaccaagccaagaagttcacgttc
aacctgatggcgaagaacataatgagcatggacccgggggaggaagagacggagcggctg
cggcgggagtacatcaccttcatgaagggcgtggtctccgcgccgctcaacctgcccggg
acgccctactggaaggctctcaagtcgcgtgctgccattctcggagtaatagagaggaaa
atggaagagcgggttgagaagctgagcaaggaggatgcaagcgtagagcaagacgatctt
ctcggatgggctctgaaacaatctaacctttcaaaagagcaaatcctggacctcttgctg
agcttgctcttcgccgggcacgagacgtcgtccatggcgctcgccctcgccatcttcttc
cttgaaggctgccccaaggctgtccaagaactgagggaggagcatcttgggattgcaagg
agacaaaggctaagaggggagtgcaaattgagctgggaagactacaaagagatggttttc
acgcaatgtgtcataaacgagacgttgcggctaggaaacgtggtcaggttcctgcaccgg
aaggtcatcaaggacgtgcactacaagggttatgacattccaagcggatggaagatcctg
ccggtgttagccgcggtgcatctggactcgtccctgtacgaggacccccagcgcttcaat
ccctggagatggaagagtagcggatcatccggcggcttggctcagagcagcagcttcatg
ccgtacggcggcgggacgcggctgtgcgccgggtcggagctcgcgaagctggagatggcc
gtgttcttgcaccacctggtgctcaacttcaggtgggagctcgccgagccggaccaagcc
ttcgtcttccccttcgtcgacttccccaagggccttcccattagggttcatagaattgca
caggatgatgagcaggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336116
Entry
4336116           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 724B1
  KO
K12639  steroid 22S-hydroxylase [EC:1.14.14.178]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4336116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4336116
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.178  steroid 22S-hydroxylase
     4336116
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP724 family
   4336116
SSDB
Motif
Pfam: p450 GyrB_insert
Other DBs
NCBI-GeneID: 4336116
NCBI-ProteinID: XP_015635418
UniProt: Q6F4F5
LinkDB
Position
4:complement(23467170..23471683)
AA seq 480 aa
MVGGELVLAALVILLALLLTLVLSHFLPLLLNPKAPKGSFGWPLLGETLRFLSPHASNTL
GSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSS
MLVVLGEDHKRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFC
EEARKFAFSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKAVQARAR
ISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGYETTSLLISMV
VYFLGQSAQDLELVKREHEGIRSKKEKDEFLSSEDYKKMEYTQHVINEALRCGNIVKFVH
RKALKDVRYKEYLIPSGWKVLPVFSAVHLNPLLHGNAQQFQPCRWEGASQGTSKKFTPFG
GGPRLCPGSELAKVEAAFFLHHLVLNYRWRIDGDDIPMAYPYVEFQRGLPIEIEPLCSES
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggtgggaggagagcttgtgctggctgctctggtgatcctgcttgctttgctgctgacc
ctggtgctgagccacttcctgcctttgctcctgaatcccaaggctcccaagggaagcttt
gggtggcctctccttggtgagacgctgaggttcctcagtcctcatgctagcaacaccctg
ggcagcttcctggaggatcactgctccaggtatgggagggtgtttaagtcccatctgttc
tgcacccccaccatagtgtcctgtgaccaggagctgaaccacttcatccttcagaatgag
gagaggctgtttcagtgcagctaccccaggccaattcatggcattctgggcaagtcctcc
atgttagtggtcctaggggaggaccacaagaggctcaggaaccttgctctagcactggtc
acctccacaaagctcaagcccagctaccttggcgacattgagaagattgcactgcatata
gttgggtcatggcatggcaagagcaaggacaaggggatggtcaatgtcatcgccttctgc
gaggaggcaagaaagtttgcattcagtgtaatagtgaagcaggtgctggggctatcacca
gaggagccggtcactgccatgatacttgaagatttcctcgccttcatgaagggtctcatc
tctttccctctctacatcccagggacgccctatgccaaagctgtgcaggccagagcgagg
atatcaagcactgtgaagggtattattgaggagaggaggaatgctggctccagcaacaag
ggtgatttccttgatgtgctgctttcaagcaatgagctctctgatgaggagaaagtgagc
tttgtgctggattccttactgggaggatatgagaccacctcactcttgatctccatggtt
gtgtatttccttgggcagtcagctcaagatctggaactagtgaagagggagcatgaaggc
ataagatcgaagaaagagaaggacgagttcttgagctctgaagactataagaagatggaa
tatacccaacatgttatcaatgaggcactgagatgtggcaacattgtcaagtttgtccac
aggaaggctctcaaagatgtcagatacaaagagtatctgattccttctggttggaaggtc
ctacctgttttcagtgctgttcatttgaaccccttacttcatggaaatgcccaacaattt
cagccctgcagatgggagggtgcaagccaagggacaagcaagaagtttacgccgttcggc
ggtggcccccggctctgccctggatcagagcttgcaaaagtagaggctgctttcttcctc
catcaccttgtgctcaattatagatggagaatcgatggcgatgacattccgatggcatac
ccgtacgtggagttccagagaggtctgcccatagaaatcgagccactttgctctgaatcc
tga

DBGET integrated database retrieval system