KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332184
Entry
4332184           CDS       T01015                                 
Name
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4332184
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332184
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4332184
   00430 Taurine and hypotaurine metabolism
    4332184
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4332184
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 4332184
NCBI-ProteinID: XP_015627912
UniProt: A3AFV5 Q84U04
LinkDB
Position
3:7181072..7184038
AA seq 492 aa
MVLSKAVSESDMSVHSTFASRYVRASLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPLGEDETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRKAEGKPFDKPNIITGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDMVNENTICVAAILGSTLNGEFEDVKLLNDLLDKKNKETGWETP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRNKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLVK
TGRFDIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRLMPPVPPAPLLVVAKKSELETQRSVTEAWK
KFVLAKRTNGVC
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggtgctctccaaggccgtctccgagagtgacatgtccgtgcactccaccttcgcctcc
cgctacgtccgcgcctccctcccaaggtaccggatgccggagaactcgatcccgaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctg
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatcatggccgccatc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctccagaaccggtgc
gtgaacatgatcgcgcacctgttccacgcgccgctcggggaggacgagacggcggtgggc
gtgggcacggtgggttcgtcggaggccatcatgctggccgggctggccttcaagcggcgg
tggcagaacaagcgcaaggccgaggggaagccgttcgacaagcccaacatcatcaccggc
gccaacgtgcaggtgtgctgggagaagttcgcccgctacttcgaggtggagctcaaggag
gtgaagctccgcgacggctactacgtcatggaccccgagaaggccgtcgacatggtcaac
gagaacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttcgaggac
gtcaagctactcaacgacctcctcgacaagaagaacaaggagactgggtgggagacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggagctggag
tgggacttccggctgccgtgggtgaagagcatcaacgtgagcggtcacaagtacgggctc
gtctacgccggcatcggctggtgcatctggcgcaacaaggaggacctgcccgaggagctc
atcttccacatcaactacctcggcaccgaccagccaaccttcaccctcaacttctccaag
ggctccagccaggtcatcgcccagtactaccagctcatccgccacggcttcgaggggtac
aggaacatcatggagaactgccacgagaacgcgatggtgctgaaggaagggctggtgaag
acggggaggttcgacatcgtgtccaaggacgaaggggtgccgctggtggcgttctcgctc
aaggaccggagccggcacgacgagttcgagatctccgacatgctgcgccgcttcggctgg
atcgtgccggcgtacaccatgccgcccgacgcccagcacgtcacggtgctccgcgtggtc
atccgggaggagttcagccgcaccctcgccgagcgcctcgtcctcgacatcgagaaggtg
atgtaccagctcgacgcgctcccctccaggctcatgccccccgtgccgccggcgccgctg
ctggtggtcgccaagaagtcggagctcgagacgcagcggtcggtgacggaggcgtggaag
aagttcgtgctcgccaagaggaccaacggcgtctgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333932
Entry
4333932           CDS       T01015                                 
Name
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4333932
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4333932
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4333932
   00430 Taurine and hypotaurine metabolism
    4333932
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4333932
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 4333932
NCBI-ProteinID: XP_015631723
UniProt: Q6ASV4 A0A0P0W315
LinkDB
Position
3:29200215..29208676
AA seq 492 aa
MVLSHGVSGSDESVHSTFASRYVRTSLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPAKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKQGLEK
TGRFNIVSKDNGVPLVAFSLKDSARHNEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDVEKVLHELDALPARVVANGGDAAAASASEREMEKQREVISLWKR
AVLAKKKTNGVC
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggtgctctcccacggcgtgtcgggctccgatgagtccgtccactccacgttcgcctcc
cgctacgtccgcacctccctccccaggttccggatgccggagcagtcgatccccaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctc
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatccaggcctccgtc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgaactccagaaccgatgt
gtgaacatgattgcacacctcttcaatgctcctctaggggactctgaaacggccgtcgga
gtcggcactgtcggctcgtctgaggccatcatgctcgccggtttggccttcaagaggagg
tggcagaacaagatgaaggcagccggcaagccatgcgacaagcctaacattgtcaccggc
gccaatgtccaagtttgctgggagaagttcgcgcgatacttcgaggttgagctcaaggaa
gtgaagctgagtgacggctactacgtcatggacccagctaaggccgtggatatggtcgac
gagaacaccatctgcgtcgcggcgatcctcgggtcgacgctgaacggggagttcgaggac
gtgaagctgctcaacgatctgctcaccaagaagaacgctgaaacaggctgggacacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggagctggag
tgggacttccggctgccgctggtgaagagcatcaacgtgagcgggcacaagtacggcctc
gtctacgccgggatcgggtggtgcatctggaggagcaaggaggatctgcctgaggagctc
atcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttctccaag
ggttccagccaggtcattgcacagtattaccaactaatccgcctaggctttgaggggtac
aagaacatcatggagaactgccaggagaacgcgatggtgctgaagcaggggctggagaag
acggggcggttcaacatcgtgtccaaggacaacggcgtgccgctggtggccttctccctc
aaggacagcgcccggcacaacgagttcgagatctccgacttcctccgccgcttcggctgg
atcgtgccggcctacaccatgccccccgacgcgcagcacgtcaccgtgctccgcgtcgtc
atccgcgaggacttcagccgcacgctcgccgagcgcctcgtgctcgacgtcgagaaggtg
ctgcacgagctcgacgcgctccccgcccgcgtcgtcgccaacggcggcgacgccgccgcc
gcgtcggcgagcgagagggagatggagaagcagcgcgaggtgatctccctctggaagagg
gccgtgctggccaagaagaagaccaacggcgtctgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335973
Entry
4335973           CDS       T01015                                 
Name
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4335973
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4335973
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4335973
   00430 Taurine and hypotaurine metabolism
    4335973
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4335973
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 4335973
NCBI-ProteinID: XP_015634458
UniProt: Q0JCV8 Q7XV14
LinkDB
Position
4:complement(22314071..22316440)
AA seq 484 aa
MALSTAQTGESMHSSTFASRYVRTALPRFRMPEKSIPKDAAYQIINDELMLDGNPRLNLA
SFVTTWMEPECDKLMMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGV
GTVGSSEAIMLAGLAFKRKWQNRMKAEGKPHDKPNIVTGANVQVCWEKFARYFEVELKEV
KLTQGYYVMNPEKAVEMVDENTICVAAILGSTLNGEFEDVKMLNDLLTAKNAETGWNTPI
HVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPDELI
FHINYLGADQPTFTLNFSKGSNQIIAQYYQLIRLGFEGYKDIMQNCRDNATVLREGIEKT
GHFDVVSKDSGVPLVAFSLKDSSRYTVFEVAESLRRFGWIVPAYTMPADAEHVAVMRVVI
REDFSRGLAERLITDLTKTVADMDAHAVKKAAAEPAKKTVREIEKEVTTYWRSFVARKKS
SLVC
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgctgtcgacggcgcagacaggggagtcgatgcactcctcgacgttcgcgtcgcgg
tacgtgcgcacggcgctgccgaggttcaggatgccggagaagtcgatccccaaggacgcg
gcgtaccagatcatcaacgacgagctgatgctcgacggcaacccgcgcctgaacctggcg
tccttcgtcaccacgtggatggagcccgagtgcgacaagctcatgatggccgccatcaac
aagaactacgtcgacatggatgagtaccccgtcaccaccgagctccagaaccggtgcgtg
aacatgatcgcgcatctgttcaacgcgccgatcggggacgacgagacggcggtcggggtg
ggcacggtggggtcgtcggaggccatcatgctggcggggctggcgttcaagaggaagtgg
cagaacaggatgaaggccgaggggaagccccacgacaagcccaacatcgtgacgggggcc
aacgtgcaggtgtgctgggagaagttcgcgcgctacttcgaggtggagctcaaggaggtg
aagctgacccaagggtactacgtgatgaacccggagaaggccgtggagatggtcgacgag
aacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttcgaggacgtc
aagatgctcaacgacctcctcaccgccaagaacgccgagacagggtggaacacgccgatc
catgtggacgcggcgagcggcgggttcatcgcgccgttcatctacccggagctggagtgg
gacttccggctgccgctggtgaagagcatcaacgtcagcggccacaagtacgggctcgtc
tacgccggcgtcgggtgggtcatctggcgcaacaaggaggacctccccgatgagctcatc
ttccacatcaactacctcggcgccgaccagccaaccttcacgctcaacttctccaaagga
tcgaaccagataattgcgcagtattaccagctcattcgtctcggattcgaggggtacaag
gacatcatgcagaactgccgggacaacgcgacggtgctccgggaggggatcgagaagacg
ggccacttcgacgtggtgtccaaggactccggcgtgccgctggtggccttctccctcaag
gactcgtcgcggtacacggtgttcgaggtggccgagagcctccgccgcttcggctggatc
gtgccggcgtacaccatgcccgccgacgctgagcacgtcgccgtgatgcgcgtcgtcatc
cgcgaggacttcagccgcggcctcgccgagcgcctcatcaccgacctcaccaagacggtg
gccgatatggacgcccacgccgtcaagaaggccgccgccgagccggccaagaagaccgtg
cgggagatagagaaggaggtgaccacctactggcggagtttcgtcgccaggaagaagagc
agcctcgtctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335977
Entry
4335977           CDS       T01015                                 
Name
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4335977
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4335977
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4335977
   00430 Taurine and hypotaurine metabolism
    4335977
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4335977
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Other DBs
NCBI-GeneID: 4335977
NCBI-ProteinID: XP_015633915
UniProt: Q0JCV4 Q7XV18
LinkDB
Position
4:22330172..22332546
AA seq 500 aa
MVLTHVEAVEEGSEAAAAVFASRYVQDPVPRYELGERSISKDAAYQIVHDELLLDSSPRL
NLASFVTTWMEPECDRLILEAINKNYADMDEYPVTTELQNRCVNIIARLFNAPVGDGEKA
VGVGTVGSSEAIMLAGLAFKRRWQNRRKAAGKPHDKPNIVTGANVQVCWEKFARYFEVEL
KEVKLTEGCYVMDPVKAVDMVDENTICVAAILGSTLTGEFEDVRRLNDLLAAKNKRTGWD
TPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPE
ELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQFLRLGFEGYKSVMKNCMESARTLREGL
EKTGRFTIISKEEGVPLVAFTFKDGAGAQAFRLSSGLRRYGWIVPAYTMPAALEHMTVLR
VVVREDFGRPLAERFLSHVRMALDEMDLAARAPVPRVQLTIELGPARTAGEEASIRVVKS
EAVPVRKSVPLVAGKTKGVC
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggttctgacgcacgtcgaggcggtggaggagggcagcgaggcggcggccgccgtgttc
gcgtcgaggtacgtgcaggacccggtgccgaggtacgagctcggcgagaggtcgatatcc
aaggacgccgcgtaccagatcgtccacgacgagctcctcctggacagcagcccgcgcctg
aacctggcgtccttcgtcaccacctggatggagcccgagtgcgacaggctcatcctcgag
gccatcaacaagaactacgccgacatggacgagtaccccgtcaccaccgagctccagaac
cggtgcgtgaacatcatagcgaggctgttcaatgcgccggtgggcgacggcgagaaggcg
gtcggggtgggcacggtggggtcgtcggaggccataatgctggccgggctggcgttcaag
cggcggtggcagaaccggcggaaggcggcggggaagccccacgacaagcccaacatcgtg
acgggggccaacgtgcaggtgtgctgggagaagttcgcgcgctacttcgaggtggagctc
aaggaggtgaagctgaccgaaggctgctacgtgatggaccccgtcaaggccgtggacatg
gtcgacgagaacaccatctgcgtcgccgccatcctcggctccaccctcaccggcgagttc
gaggacgtcaggcgcctcaacgacctcctcgccgccaagaacaagcggacgggttgggac
acgccgatccacgtcgacgcggcgagcggcgggttcatcgcgccgttcatctacccggag
ctggagtgggacttccggctgccgctggtgaagagcatcaacgtcagcggccacaagtac
gggctcgtctacgccggcgtcgggtgggtcatctggcgcaacaaggaggacctccccgag
gagctcatcttccacatcaactacctcggcgccgaccagccaaccttcacgctcaacttc
tccaaagggtccagtcagattattgcgcaatattaccagtttcttcgactcggatttgag
gggtacaagagcgtgatgaagaactgcatggagagcgcgaggacgctccgggagggcctg
gagaagacggggcggttcaccatcatctccaaggaggagggcgtgccgctggtggccttc
acgttcaaggacggcgccggcgcgcaggccttcaggctgtcgtcgggcctgcgccggtac
gggtggatcgtgccggcgtacacgatgccggcggcgctggagcacatgacggtgctccgc
gtcgtcgtccgggaagacttcggccggccgctcgccgagcggttcctgtcccacgtcagg
atggccctggacgagatggacctcgccgccagggcccccgtgcccagggtgcagctcacc
atcgagctcggccccgcccggaccgccggcgaggaggcctcgatcagggtggtcaagagc
gaggccgtgcccgtgcgcaagagcgtcccgctcgtcgccggcaaaaccaagggcgtttgc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345787
Entry
4345787           CDS       T01015                                 
Name
(RefSeq) glutamate decarboxylase isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4345787
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4345787
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4345787
   00430 Taurine and hypotaurine metabolism
    4345787
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4345787
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 4345787
NCBI-ProteinID: XP_015650123
UniProt: Q0J553 Q9AQU4
LinkDB
Position
8:complement(22878705..22882991)
AA seq 501 aa
MVVSVAATDSDTAQPVQYSTFFASRYVRDPLPRFRMPEQSIPREAAYQIINDELMLDGNP
RLNLASFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDE
TAIGVGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEV
ELKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNNLLTEKNKETG
WDVPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKEDL
PEELIFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCMENTAILRE
GIEATGRFEILSKEAGVPLVAFSLKDSGRYTVFDISEHLRRFGWIVPAYTMPANAEHVAV
LRVVIREDFSRSLAERLVSDIVKILHELDAHSAQVLKISSAIAKQQSGDDGVVTKKSVLE
TEREIFAYWRDQVKKKQTGIC
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtggtgagcgtggccgcgaccgactcggacacggcccagccggtgcagtactccacc
ttcttcgcctcccgctacgtccgcgacccgctcccgcggttcaggatgccggagcagtcg
atcccgagggaggcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccg
cggctgaacctggcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatc
atggactccgttaacaagaactacgtcgacatggacgagtaccctgtcaccacggagctc
cagaaccgttgtgtgaatatgatagctcacctgttcaatgcaccaatcaaggaggatgaa
acagctattggagttgggacggtgggatcctcagaagcaattatgcttgcaggactggca
ttcaagaggaagtggcaaaacaaacggaaggaacaggggaagccatgtgacaaacccaac
attgttactggtgctaatgttcaggtttgctgggagaaatttgccagatattttgaagta
gaactgaaggaggttaagctcagtgaaggatactatgtcatggatcctgtaaaggctgtt
gaaatggtggatgagaacactatatgcgttgcggccatcttgggctctactctcactgga
gagtttgaggatgttaagttattgaataatctcctaacagaaaagaataaggaaactggg
tgggatgtgccaattcatgttgatgcagcaagtggaggatttatagcaccttttctatac
cctgagcttgaatgggacttcaggctaccactggtgaagagcatcaatgtcagtgggcac
aagtatggccttgtgtatccaggtgttggttgggtcatttggcgaagcaaagaggatttg
cctgaagaactcattttccatataaactatctggggacagaccagccgacgttcactctg
aacttctccaaaggttccagccagataatcgcacagtactatcaactaatacgcctggga
ttcgagggatacaagaacatcatgcagaattgcatggagaacacagcaatactaagggaa
ggcatagaggcgactggtcgattcgaaatcctctccaaggaggccggtgtgcccttggtg
gcgttctcgctcaaggacagcggcaggtacaccgtgttcgacatctccgagcacctgagg
aggttcggctggatcgtgccggcgtacaccatgccggccaacgccgagcacgtcgccgtc
ctccgcgtcgtcatcagggaggacttcagccggagcctcgccgagcggctcgtctcggac
atcgtcaagatcctgcacgagctggacgcccattcggcccaggtgctgaagatctccagc
gccatcgcgaagcagcaatcgggcgacgatggcgtggtcaccaagaagagcgtcctggag
accgagagggagatcttcgcgtactggagggaccaggtgaagaagaagcagaccggaatc
tgctag

DBGET integrated database retrieval system