KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332209
Entry
4332209           CDS       T01015                                 
Name
(RefSeq) NHP2-like protein 1
  KO
K12845  U4/U6 small nuclear ribonucleoprotein SNU13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332209
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4332209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332209
   03009 Ribosome biogenesis [BR:osa03009]
    4332209
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4332209
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    4332209
SSDB
Motif
Pfam: Ribosomal_L7Ae PELOTA_1
Other DBs
NCBI-GeneID: 4332209
NCBI-ProteinID: XP_015628149
UniProt: A0A8J8Y351 Q10PA5
LinkDB
Position
3:7476243..7478190
AA seq 128 aa
MSQEVVNPKAYPLADAQLTMTILDLVQQASNYKQLKKGANEATKTLNRGISEFVVMAADT
EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEGSQLKTPIQNLK
DAIEKLLI
NT seq 387 nt   +upstreamnt  +downstreamnt
atgagccaggaggtcgtgaaccctaaggcctacccgctggcggacgcgcagctgacgatg
accatcctcgacctcgtccagcaggcctccaattacaagcagctcaagaagggggccaac
gaagcgacgaagaccctgaacaggggtatatcagagttcgtggtgatggcggccgacacg
gagccgctcgagatccttctccacctccccctgctcgcggaggataagaacgttccatat
gtttttgtcccttcgaagcaagcccttggccgcgcatgtggcgttactagacctgtcatt
gcttgttcagtgaccagcaacgagggcagtcagctgaagacaccgatacagaatctcaag
gatgctatcgagaagctcctcatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348007
Entry
4348007           CDS       T01015                                 
Name
(RefSeq) 13 kDa ribonucleoprotein-associated protein
  KO
K12845  U4/U6 small nuclear ribonucleoprotein SNU13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4348007
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4348007
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4348007
   03009 Ribosome biogenesis [BR:osa03009]
    4348007
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4348007
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    4348007
SSDB
Motif
Pfam: Ribosomal_L7Ae PELOTA_1
Other DBs
NCBI-GeneID: 4348007
NCBI-ProteinID: XP_015613502
LinkDB
Position
10:1529949..1532223
AA seq 194 aa
MAVISFYCRETKQMQMSLNSGSFDVTQPNSPFLNGLGDKTLPNPFSSPPPPTTKPHLPPP
AADEPQTKMAEVNPKAYPLADSQLAQAIQELVSQAANYKQLKKGANEATKTLNRGIAEFV
VMAADAEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASNLRD
PINNLKVAIEKLLI
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctgtcattagcttctactgtagagaaactaaacagatgcagatgtctctaaactcg
ggatcttttgatgtaacccaaccgaattctcctttcctgaatggattaggagataaaacc
ctacctaaccccttctcttcccctccgccgccgacgaccaaaccccacctcccacccccc
gccgccgacgagccacagacgaagatggcggaggtgaacccgaaggcgtacccgctcgcc
gactcgcagctggcgcaggcgatccaggagctcgtcagccaggccgccaactacaagcag
ctcaagaagggcgccaacgaagcgacgaagacgctcaacagagggatcgcggagttcgtg
gtgatggcggccgacgccgagcccctcgagatccttctccaccttcccctcctcgccgag
gacaagaatgtgccatacgtctttgtcccatcaaagcaagctctcggccgtgcatgtggg
gtgacgaggcccgtgatcgcctgctcggtgaccagcaatgaggccagcaacttgagagat
ccaatcaataacctcaaggtcgctattgagaagctcctgatctga

DBGET integrated database retrieval system