KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332222
Entry
4332222           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 4 homolog
  KO
K03029  26S proteasome regulatory subunit N10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4332222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4332222
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4332222
SSDB
Motif
Pfam: VWA_2 UIM Ssl1 GHMP_kinases_N TcpF
Other DBs
NCBI-GeneID: 4332222
NCBI-ProteinID: XP_015632315
UniProt: O82143
LinkDB
Position
3:complement(7579516..7583811)
AA seq 402 aa
MVLEATMICIDNSEWMRNGDYSPSRFQAQADAVNLICGAKTQSNPENTVGVMTMAGKGVR
VLVTPTSDLGKILACMHGLEVGAEANLAAAIQVAQLALKHRQNKRQQQRIIAFIGSPVKY
DKKVLETIGKKLKKNNVALDIVDFGETDDDKPEKLEALISAVNSSDSSHIVHVPPGENAL
SDVLISTPIFTGEEGGSGFAASAAAAAATGAAGFEFDVDPNVDPELALALRLSMEEERAR
QEAIAKKAAEESSGAENKDHASSSNADSVMAEAEPASNAADDKKDQPKEDDDAQLLQQAL
AMSMEEGSSGAAAADAAMAEAAVDDQDLALALQMSVQDAGGSSQSDMSKVFEDRSFVTSI
LNSLPGVDPNDPSVKDLLASLHGQGEQEKKEDKSDKPEDEKK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggtgctcgaggcgacgatgatctgcatagacaactcggagtggatgcggaacggcgac
tactcgccgtcgcgattccaggctcaggccgacgccgtcaacctcatctgtggcgccaag
acccagtccaacccggagaacacggtgggcgtcatgacgatggccggaaagggcgtgcgc
gtgctcgtcactcccaccagcgacctcggcaagatcctcgcttgtatgcacggacttgaa
gttggtgctgaagcaaatttggctgcagcaattcaggttgctcagctggctctgaagcat
cgccagaataagaggcagcaacagcggattatagcttttattggaagccctgtgaaatac
gacaagaaagttttggaaacaatcgggaaaaagctgaagaagaataatgtggctcttgac
atcgttgactttggtgaaaccgatgatgataagcctgagaaactggaagcgctaatctct
gctgtgaacagtagtgatagcagccacatcgttcatgtccctcccggtgaaaatgccctt
tccgatgtgcttataagtactcctatcttcactggtgaagaaggtggaagcggttttgct
gcttctgcagcagcagcagcagctactggtgcagctggatttgaatttgatgtggaccca
aatgtagatccagaattggcactcgccctgcggttgtccatggaagaagagcgagcaagg
caagaggctattgcgaagaaggccgcagaagaatcttctggtgctgaaaataaggaccat
gcctcaagctcaaacgctgattctgttatggcagaagcggaacctgcctcaaatgctgct
gatgataaaaaagatcagccgaaggaagatgatgatgctcagctactacaacaggctctt
gcaatgtcaatggaggagggttcttcaggggctgcagcggctgatgctgctatggcagag
gctgctgtagatgaccaggacttggcactagctcttcaaatgtctgtccaggacgcaggc
gggtctagtcagtctgatatgagcaaggtgtttgaagacagatcatttgttacatccatc
cttaactctctccctggtgttgaccccaatgacccctctgtgaaagatttgctggcatca
ttgcatgggcagggcgagcaagagaagaaggaagacaaatcagacaagccagaagatgag
aagaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348083
Entry
4348083           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 4 homolog
  KO
K03029  26S proteasome regulatory subunit N10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4348083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4348083
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4348083
SSDB
Motif
Pfam: VWA_2 VWA Ssl1 VWA_3
Other DBs
NCBI-GeneID: 4348083
NCBI-ProteinID: XP_015613355
UniProt: A3C2G2
LinkDB
Position
10:complement(2525880..2531645)
AA seq 342 aa
MVLELEATVICVDDSEWMRNGDYPPTRLQAQEDAANLVVGTKMTSNPENTVGVLAMAGDR
VRVLLAPTSDPVKFLACMHGLEASGEANLTATLNIAELVLKNRPDKRLSQRIVVFVGSPV
KDEKLETIGKKLKKYNVSLDVVEFGESDDEKPEKLEALVAAVGGSSHIVHIPPGEDLRAV
LANTPIITGDEGGGAAAGGASRYEYNVDPNVDPEFAEALRLSEIARQEAAADGASRYEYS
VDPNADPELAETFRLAAGEPSTSNTDTVLLESDSDTYVPFHEFIQNNPFVTGAESASDRP
ADDERATEEGFRMIREALARSANAAHAEISGNSSSGQELELG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtgctcgagctcgaggcgacggtgatatgcgtggacgactccgagtggatgcggaac
ggcgactacccgccgacgcggctccaggcgcaggaggacgccgccaacctcgtcgtcggc
actaaaatgacgtcgaacccggagaacacggtcggggtgctggccatggctggggacaga
gtgcgcgtgctcctcgcgcccaccagcgaccccgtcaagttcctcgcctgcatgcacggg
ctggaagctagtggtgaagcaaatttgactgctactctaaatattgctgaactggtactt
aaaaatcgtcccgacaaaagactgagtcagaggatagttgtttttgttggcagccctgta
aaagatgaaaagttagagacaattggaaaaaagctgaagaagtataatgtttctcttgat
gttgttgaatttggcgaatctgacgatgaaaagcctgagaaactagaagctcttgttgct
gcagttggtggcagcagccacatagttcacatcccacctggggaagatcttcgtgccgtc
cttgccaatacaccgataattactggagatgaaggagggggtgctgcagccggtggagca
tctagatatgaatacaatgttgacccaaatgtggatccagagtttgcagaagcacttcgt
ttatcagagatagcaaggcaagaagctgcagccgatggagcatctagatatgaatacagt
gttgacccaaatgcggatccagagttagcagaaacatttcgtttggctgcaggggaacct
tcaacctcaaacactgatactgttctcttggaatctgactcagacacttatgttcctttt
catgagttcatacaaaataatccttttgtgactggagcggaatctgcctcagatagacct
gctgacgatgagagggcaacggaagaagggttccgtatgatacgagaagctcttgcaagg
tctgcaaatgcagcacatgctgaaatatcaggcaattcctcatctgggcaggagttggaa
ttaggttaa

DBGET integrated database retrieval system