KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332257
Entry
4332257           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S20-1
  KO
K02969  small subunit ribosomal protein S20e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332257
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4332257
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-GeneID: 4332257
NCBI-ProteinID: XP_015628712
UniProt: A0A8J8YEJ9 Q10P27
LinkDB
Position
3:7884802..7886804
AA seq 127 aa
MAAAAVYGGMKGGKLGVEEAHELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLRVKG
PVRIPTKVLHITTRKSPCGEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPGVEV
EVTIADV
NT seq 384 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtgtacggcggcatgaagggcgggaagctgggcgtcgaggaggcc
cacgagctgcagctcaaccgcatccgcatcaccctctcgtccaagaacgtcaaaaacctc
gagaaagtttgtgcggatctagtgaagggggccaaggacaagcagcttagggtaaagggg
ccagttaggatccccaccaaggtgctccacatcactacccgcaagtctccctgtggtgaa
ggaacaaacacctgggatcggtttgagttccgcatccacaagagggtgattgaccttatc
agctcccctgatgtggtgaagcagataacctccataacaattgaacctggtgttgaggtt
gaggtgacaatagcagatgtgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340027
Entry
4340027           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S20
  KO
K02969  small subunit ribosomal protein S20e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4340027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4340027
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4340027
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-GeneID: 4340027
NCBI-ProteinID: XP_015643050
UniProt: P35686
LinkDB
Position
6:complement(1820084..1822082)
AA seq 128 aa
MAAADVAYAPPMKSGKIGFESSQEVQHRIRITLSSKSVKNLEKVCGDLVKGAKDKSLKVK
GPVRMPTKVLHITTRKSPCGEGTNTWDRFEMRVHKRVIDLVSSADVVKQITSITIEPGVE
VEVTISDQ
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcggccgccgacgtggcgtacgcgccgccgatgaagtccggcaagatcggcttcgag
agctcgcaggaggtgcagcacaggatccgcatcaccctctcctccaagagcgtcaagaac
ctcgagaaagtctgcggtgatctggtgaagggagccaaggacaagagcttgaaggtgaag
ggccccgtgcggatgcccaccaaggtgctccacatcaccaccaggaagtctccttgtgga
gaaggtaccaacacctgggatcggtttgagatgcgggtgcacaaaagggtgattgatctt
gtcagctctgcagatgttgtcaagcagatcacctcaatcaccattgagccaggtgtggag
gttgaagtgaccatcagcgaccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348185
Entry
4348185           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S20-1
  KO
K02969  small subunit ribosomal protein S20e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348185
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4348185
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-GeneID: 4348185
NCBI-ProteinID: XP_015614818
UniProt: A3C2X0 Q8LNL2
LinkDB
Position
10:4832044..4835041
AA seq 130 aa
MAAAAVYGAGGAMKGGKLGMEEARELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLR
VKGPVRIPTKVLHITTRKSPCGEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPG
VEVEVTIADV
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcggcggctgcggtgtacggcgccggcggcgcgatgaagggcgggaagctcggcatg
gaggaggcgcgggagctgcagctcaaccgcatccgcatcaccctctcctccaagaacgtc
aagaacctcgagaaggtttgcgctgatctggtgaagggcgccaaggacaagcagctgcgc
gtcaagggccccgtcaggatccccaccaaggtgctccacatcaccacccgcaagtcgccg
tgcggtgaaggaacaaacacatgggatcgtttcgagttccgcatccacaagcgggtgatc
gatctcatcagctccccagatgttgtgaagcagatcacctccatcaccatcgagcctggt
gtcgaggtcgaggtgacgatcgctgatgtgtaa

DBGET integrated database retrieval system