KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332293
Entry
4332293           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332293
   00020 Citrate cycle (TCA cycle)
    4332293
   00620 Pyruvate metabolism
    4332293
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4332293
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     4332293
SSDB
Motif
Pfam: PEPCK_ATP AAA_33 AAA_24
Other DBs
NCBI-GeneID: 4332293
NCBI-ProteinID: XP_015630689
UniProt: Q10NX2 Q0DTC9
LinkDB
Position
3:complement(8218895..8224177)
AA seq 663 aa
MASTPNGLARIETHGAKTKKHENGICHDDSSAPVRAQTIDELHSLQRKRSAPTTPIKDGA
SSPFAAALSEEERQRQQLQSISASLASLTRETGPKVVRGDPARKGEAAAKGAPSPHPQPV
HHHHPHVTPTIAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG
RSPRDKRIVKDEASAQELWWGKGSPNIEMDEHTFLTNRERAVDYLNSLDKVFVNDQFLNW
DTENRIKVRIISARAYHSLFMHNMCIRPTEEELEEFGTPDFTIYNAGQFPCNRYTHYMTS
STSVDINLARREMVILGTQYAGEMKKGLFGVMHYLMPRRGILSLHSGCNMGKQGDVALFF
GLSGTGKTTLSTDHNRLLIGDDEHCWSDTGVSNIEGGCYAKCIDLSQEKEPDIWNAIKFG
TVLENVVFDEHTREVDYTDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGV
LPPVSKLNLPQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAE
KMQKYGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYKKTEVFGLEIP
TEIDGIPSEILDPINTWTDKGAYKETLLKLAGLFKKNFEVFANYKIGGDSSLTDKILAAG
PNF
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggcgagcacgccgaacgggctggcgcggatcgagacgcacggggcgaagacgaagaag
cacgagaacgggatatgccacgacgacagctcggcgccggtgcgggcgcagaccatcgac
gagctccactcgctgcagcggaagcggtcggcgcccaccacgcccatcaaggacggcgcc
tcctcgcccttcgccgccgccctctccgaggaggagcgccagcgccagcagctccagtcc
atcagcgcgtcgttggcgtcgctgacgcgtgagaccgggccgaaggtcgtcaggggagat
ccggcgaggaagggcgaggccgcggcgaagggcgcgccgtcgccgcacccgcagccggtg
caccaccaccacccgcacgtcaccccgaccatcgccgtcagcgacagctccctcaagttc
acccatgtgctctacaacctctcgcctgctgagctgtacgagcaggcgatcaagtacgag
aaggggtcgttcatcacgtccaccggcgcgctggcgacgctgtccggcgccaagaccggc
cggtcgccgagggacaagcgcatcgtcaaggatgaggcctccgcgcaggagctttggtgg
ggcaagggttcgcccaacatcgagatggacgagcacactttcctcaccaacagggagagg
gccgtcgactacctcaactcccttgacaaggtgtttgtgaacgaccagttcctgaactgg
gacacggagaaccggatcaaagtccgtatcatctcggccagggcgtaccactcgctcttc
atgcacaacatgtgcatccggccgacggaggaggagctggaggagttcggcacgccggac
ttcaccatatacaacgccgggcagttcccctgcaaccggtacacgcactacatgacgtcg
tcgacgagcgtagacatcaacctcgctaggagggagatggtgatcctcggcacgcagtac
gccggggagatgaagaaggggctcttcggggtgatgcactacctcatgcccaggaggggc
atcctctccctgcactccggctgcaacatgggcaagcagggcgacgtcgccctcttcttt
ggactgtcaggtactggaaagactactctgtcaactgaccacaacaggctgctgatcggc
gacgatgagcactgctggagtgacactggcgtgtccaacatcgagggtggttgctatgcc
aagtgcatagacttgtcacaggagaaagagcctgatatttggaatgccatcaagtttggg
accgtgttggagaatgtcgtctttgatgagcacacccgtgaagttgattacaccgacaaa
tctgtcaccgagaacacgcgcgctgcttaccctatcgagtacatccccaacgccaagata
ccgtgcgtcgggccacacccgaagaacgtcattctcctggcatgcgacgctttcggcgtc
ctccctcctgtcagcaagctaaaccttccacagaccatgtaccacttcatcagtggctac
actgctctggttgccggcacggaggatggcatcaaggagccgcaggctacgttctctgct
tgcttcggtgcagcgttcatcatgctccacccgaccaagtacgccgccatgctcgccgag
aagatgcagaagtatggcgccaccgggtggctcgtcaacaccggttggtccggtggaagg
tacggagttggcaagcggatcaggctgccgtataccaggaagatcatcgacgccatccac
tccggtgagctcctcaccgccaactacaagaagacggaggtgtttggcctggagatcccc
actgaaatcgacggcatcccgtctgaaatcctcgacccgatcaacacctggacggacaag
ggcgcgtacaaggagacgctcctgaagctggctggcctgttcaagaagaacttcgaggtg
ttcgccaactacaagatcgggggagacagcagcctgacagacaagatcctcgctgctgga
ccaaacttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348268
Entry
4348268           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348268
   00020 Citrate cycle (TCA cycle)
    4348268
   00620 Pyruvate metabolism
    4348268
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348268
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     4348268
SSDB
Motif
Pfam: PEPCK_ATP AAA_33
Other DBs
NCBI-GeneID: 4348268
NCBI-ProteinID: XP_015614285
UniProt: Q7G466 Q0IYJ4
LinkDB
Position
10:complement(7438349..7444108)
AA seq 637 aa
MMEAKDGQAWLGTNGYGSRREEDGVCHDDSATPVRANTVDELHSLQRKPQVVEDRHRLQL
QSISASLASMTCGIGPKLVNGDPARKKEMAGKAVTHHQHHITVPTITVSDSDLKFTHVLY
NLSPSELYEHAIKYEKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTDDLWWGKGSPN
IEMDEQTFLINRERAVDYLNSLDKVFVNDQFLNWDPNNRIKVRIISARAYHSLFMHNMCI
RPTYEELENFGEPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLKRREMVILGTQYAGEMKK
GLFSVMHYLMPKKQILSLHSGCNMGRGGDVALFFGLSGTGKTTLSTDRNRILIGDDEHCW
SDNGISNIEGGCYAKCIDLSQEKEPDIWDAIKFGTVLENVVFDEHSREVDYTEKSVTENT
RAAYPIEYIANAKIPCVGPHPKNVILLACDAFGVLPPVSKLSHAQTMYHFISGYTALVAG
TEDGIKEPQATFSACFGAAFIMLHPTRYAAMLADKMNKHGATGWLVNTGWIGGSYGVGER
ISLAYTRKIIDAIHSGELLARSYKKTDVFGLDIPTKVEGVPSELLDPINTWEDKDSYKLT
LLKLSDLFKRNFKVFANYKKGGVSDLADEIAAAGPNF
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgatggaggcgaaagacgggcaagcatggctggggacgaacggatacggcagcaggagg
gaggaagacggcgtgtgccacgacgacagcgcgacaccggtgagggcgaacactgtcgac
gagctacactcgctgcagaggaagcctcaggtagtggaggatcgccacaggctgcagctt
cagtccatcagtgcgtctttggcatcgatgacatgtgggattgggccaaaactcgtcaac
ggtgacccagcaaggaaaaaagaaatggctggcaaggctgtgacacatcaccaacaccat
atcactgtccccacgatcactgtgagcgacagtgacctcaagttcacccatgttctgtac
aacttatccccttctgaactttatgagcatgcaatcaaatatgagaaagggtcattcatc
acatccagtggggcgttagcgacgctatcaggagcaaagaccggtcgatcacctagggac
aagcgtgttgtcaaggatgaaacaacagatgatctgtggtggggcaagggatcaccaaac
attgaaatggacgagcaaacctttctgatcaacagggagagagctgttgactacttgaac
tcccttgataaggtgtttgttaatgatcagttcctaaactgggaccccaacaataggata
aaagttcgaatcatctctgcgagggcctaccattctctcttcatgcacaacatgtgcatc
cggccaacatacgaggaactagagaattttggcgagcccgacttcaccatctacaatgct
ggacagttcccgtgcaaccgttacacgcattacatgacatcgtcaactagcatagactta
aatcttaagcggagagaaatggtcatcctgggaacacaatatgctggagagatgaagaaa
ggcctcttcagtgtgatgcactacctcatgcccaaaaagcagatcctctcgttgcactct
ggctgcaacatgggcagagggggtgatgtagccctgttttttggattgtcaggtactgga
aagacaactctgtcaacagacaggaataggatcttaattggtgatgatgaacactgctgg
agtgataatggtatctctaacattgagggcggctgctatgctaaatgcatagatctttct
caggagaaagaacctgacatttgggatgcaatcaagtttggcacagtgttggagaatgtt
gttttcgatgagcactcccgtgaagttgattatacagaaaaatctgtcacagagaatacc
cgtgctgcttaccctattgaatacatagctaatgctaagataccatgtgttgggccacac
ccaaagaatgttatcctacttgcatgtgatgcatttggtgtcctccctcctgtcagcaag
ttgagccatgcacaaaccatgtaccattttatcagtggctacactgcattggtcgctgga
actgaagatggtatcaaggagccacaggctacattttctgcctgctttggtgcagctttt
ataatgctccacccaactcggtacgctgccatgctggcagataagatgaacaagcatgga
gctaccggatggcttgtcaacactggttggatcgggggaagttatggtgtaggtgagcga
atcagcttggcctacacaaggaaaatcatcgatgccattcactcgggtgagcttttggct
agaagctacaaaaagacagatgtctttggactagacatccccacaaaagtggaaggagtt
ccatctgaattgcttgacccaataaatacctgggaagacaaagactcatacaagttgaca
cttctaaagctgtcagatctgttcaagagaaatttcaaggtatttgcaaattacaagaaa
ggtggtgttagtgatctggctgatgagattgctgctgcaggaccaaatttctga

DBGET integrated database retrieval system