KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332296
Entry
4332296           CDS       T01015                                 
Name
(RefSeq) imidazole glycerol phosphate synthase hisHF, chloroplastic
  KO
K01663  imidazole glycerol-phosphate synthase [EC:4.3.2.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4332296
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     4332296
SSDB
Motif
Pfam: His_biosynth GATase GATase_3 SNO Peptidase_C26 GATase_5 NMO
Other DBs
NCBI-GeneID: 4332296
NCBI-ProteinID: XP_015628225
UniProt: Q10NW0 Q0DTC6
LinkDB
Position
3:complement(8255442..8260808)
AA seq 568 aa
MAAATSINAVPCSAGRPKRRSQRRGASTVAVRASGDASTVTLLDYGAGNVRSVRNAIRHL
GFGIRDVRSPEDILAADRLVFPGVGAFGSAMDVLTRSGMADALREYIRRDRPFLGICLGL
QLLFDSSEENGPISGLGVIPGVVRRFDSSKGLIVPHIGWNALEITKDTQLLKGAEGHHVY
FVHSYHALPSDENKEWISSVCNYGESFISSISMGNIQAVQFHPEKSGATGLSILKNFLSP
NTSGSKVPSRRKASNLAKRVIACLDVRSNDSGDLVVTKGDQYDVRDHSSSKEVRNLGKPV
DLASQYYIDGADEVSFLNITGFRDFPLGDLPMLEVLRCASEKVFVPLTVGGGIRDFTDAN
GRYYSSLEVASEYFRSGADKISIGSDAVFAAEAYLQTGVKTGKSSLEQISRVYGNQAVVV
SIDPRRVYVKNPEEVQFKTVKVSNKGPLGEEYAWYQCTVSGGRDSRPIGAYELAKAVEEL
GAGEILLNCIDCDGQGCGFDIDLVKMVSDAVTIPVIASSGAGTVEHFSEVFEKTNASAAL
AAGIFHRKEVPISAVKEHLVDAGVEVRV
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggccgccgccacctccatcaacgccgtcccctgctccgctggtcggccgaagcggagg
agccagcgccgcggcgcctctacggtcgccgtgcgcgcgtccggcgacgctagcaccgtg
acgctgctggactacggcgcgggcaacgtgcgcagcgtgcgcaatgccatccgccacctc
ggcttcggcatccgcgacgtgcgcagcccggaggacatcctcgccgccgaccgcctcgtc
ttcccgggggtcggcgccttcggctcagccatggacgtcctcacccgctccgggatggcc
gacgcgctccgcgagtacatccgcagggaccgccccttcctcggcatctgcctcggcctc
cagcttctcttcgactctagcgaggagaatggcccgataagcggccttggtgtgatacct
ggagttgtcaggcgatttgactcttcgaagggtctcattgtgcctcacattggctggaat
gctttggagatcaccaaagacacgcagctgctcaagggagctgaaggccaccatgtgtac
tttgttcactcctatcatgctctgccttcagatgaaaacaaagagtggatttcttctgtg
tgcaactatggcgagagtttcatatcatccatctcaatgggcaacattcaggcagttcag
tttcacccagaaaagagcggagctactgggctttcaattttgaaaaattttctcagtcca
aacacttcaggatcaaaggtcccatctcgtaggaaagcatcgaaccttgcaaagagagtc
attgcatgtcttgatgttcggtcaaatgatagtggggatcttgtggtaacaaaaggtgac
cagtatgatgtaagagaccatagtagtagcaaagaggtaagaaacctcgggaagccagtg
gatttagcaagccagtactacatagatggtgctgatgaggttagcttcttgaatataact
ggtttccgtgactttccgttgggagatttgccaatgctagaggtattacgttgtgcatct
gagaaagtatttgtgccacttacagttggtggaggtataagagacttcacagatgcaaat
gggagatactactcaagtttggaagtagcgtcagagtacttcaggtctggtgctgacaag
atttcaattggtagtgatgccgtttttgctgctgaagcctatttgcagactggtgtaaag
acaggaaaaagcagcttggagcaaatctctagagtatatggcaaccaggcagttgttgta
agtattgaccctcgaagagtatatgtcaagaatccggaagaggtgcaattcaaaactgta
aaggtgtccaataaaggtccattaggagaagaatatgcatggtaccagtgcacagtaagt
ggtgggcgtgacagccgtcctataggagcatatgaactagccaaagcagttgaagaattg
ggtgctggagaaatacttcttaattgcattgattgtgatggccagggctgcggatttgac
atagatctggtaaaaatggtgtcagatgctgtgactatccctgtcattgcaagcagtggt
gctggtactgtcgaacatttttctgaggtctttgagaaaacaaatgcttctgctgccctt
gctgctggcattttccatcggaaagaggttccgatttcagcagtgaaagagcatctggta
gatgctggcgtggaggtcagagtgtag

DBGET integrated database retrieval system