KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332325
Entry
4332325           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K13414  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4332325
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4332325
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4332325
Protein kinases [BR:osa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4332325
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal ABC1 YrbL-PhoP_reg Kdo
Other DBs
NCBI-GeneID: 4332325
NCBI-ProteinID: XP_015633020
UniProt: Q10NR1
LinkDB
Position
3:complement(8572927..8577506)
AA seq 597 aa
MGPPAAPPSPSSSSGGSSRRRRRLERRNAAKHIGYDASNFCAYPQSPPAASAPASGSPSL
ACSPACSLDLTSFRIGGSGDGCRDVQLLCSSLGLSGVDDFAVPVADWEAHKAGRSSFSSS
ASTPKPREEPPARDSPVRREVAAEEEPPSLPAPAAAPVLPAKETPRSVAIEAPAPLLRVD
PWEPARPDVRKASGEGGIKGVRPPPVVLKPPPSMVRPAVCVVESTWDILRSFAPEEDSHA
HAPASRSGGDSACQDAGEEEDDAAAVLTLEELRLGETSEEFTGTSSLSTTNDDETSSTTT
ESMFYISPNGRFRRKIRSWNRGMLLGSGSFGTVFEGISDEGVFFAVKEVCLCDQGSNAQQ
CIFQLEQEIALLSQFEHENIVQYYGTDKEDSKLYIFLELVTQGSLASLYQKYRLRDTHVS
AYTRQILNGLTYLHERNIVHRDIKCANILVHANGSVKLADFGLAKEITKFNVLKSCKGTV
YWMAPEVVNPKTTYGPEADIWSLGCTVLEMLTRQLPYPGLEWTQALYRIGKGEPPAIPNC
LSRDARDFISQCVKPNPQDRPSAAKLLEHPFVNRSMRSIRSMRTSSRSNSSVRGING
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggggccgcccgccgcgccgccgtcgccgtcgtcgtcgtctgggggctcgtcgaggcgg
cgccgccggctcgaacgccggaacgccgcgaagcacatcggatacgacgcctcgaacttc
tgcgcctacccgcagtccccgcccgccgcgtccgcgcctgcgtccgggtcgccgtcgctc
gcctgctccccggcgtgctccctcgacctcacgagcttccggatcggcgggagcggcgac
gggtgcagggacgtgcagctgctctgctccagcctcggcctctccggcgtcgacgacttc
gccgtccccgtcgctgactgggaggcgcacaaggccggccgctcctccttctcctcctcc
gcctccacccccaagccgcgcgaggaaccccccgcgagggactctcctgtccgccgcgag
gttgccgccgaggaggagccgccctccctgcccgcccccgccgctgctcccgtgctcccg
gcgaaggaaacgcccaggtccgtggcaattgaagctccagcgcccctattacgggtggat
ccgtgggagccagcccgtccagatgtgaggaaggcgagcggcgagggagggatcaagggc
gtgcggccgccgccggtcgtgctcaagccgccgccgtcgatggtacggccggcggtctgc
gtggtggagtccacgtgggatatcttgcggtcgttcgcgccggaggaggatagccatgct
cacgccccggcgagcagatctggtggtgattccgcatgccaggacgcgggtgaggaggag
gatgatgcggccgcggtgttgacgctggaggagctcaggctaggggagacgtccgaggaa
ttcacgggcacgtcttcgctgtcgacgacgaacgatgacgagacgtcgagcacaaccacc
gagtccatgttctacatctcgccgaatgggaggtttaggaggaagatccggtcgtggaac
cgggggatgctcctgggaagtggctcgtttgggacagtcttcgaggggatcagcgacgaa
ggtgtcttctttgctgtcaaagaggtctgcttgtgtgatcaagggagcaatgcacagcag
tgcatttttcagcttgagcaggaaatcgcacttttgagtcagtttgaacatgaaaatatt
gtgcagtactatggtaccgacaaagaggactcaaaactgtacatcttccttgaattagtc
acccaaggatctcttgcatctttgtatcagaagtacagactgcgagatactcatgtttca
gcatatacaagacagattcttaatgggttgacttacctgcatgagcgaaacattgttcat
agggatatcaaatgtgccaatatattggtgcatgccaatggatccgtgaaacttgctgac
tttggtcttgctaaggagattaccaaattcaacgtgcttaaatcgtgcaaaggaactgtt
tattggatggcacctgaggttgtcaatcccaagacaacatatggacctgaagctgatata
tggagtctgggctgcacagtcctagagatgttgacacgtcaacttccctatcctggtctg
gaatggacacaagctttatacaggattgggaagggggaaccaccagcaattccaaattgc
ctttctagggatgctcgtgattttataagccagtgcgtaaaacccaatccgcaagacaga
ccctctgcagcaaagctgctggagcatcctttcgttaataggtcaatgcggtcgataagg
tctatgaggacatcttcgcgctcaaattcatcggtacgcggcataaatggatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333845
Entry
4333845           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K13414  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4333845
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4333845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4333845
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4333845
Protein kinases [BR:osa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4333845
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal ABC1 YrbL-PhoP_reg Kdo
Other DBs
NCBI-GeneID: 4333845
NCBI-ProteinID: XP_015630324
UniProt: Q75I98 Q0DPA7
LinkDB
Position
3:complement(28269546..28275775)
AA seq 654 aa
MFSWSRKQSSSSGRRGADASSMDSSSRGGGGEGSGSGSRGRSSRLERRNAVKHIDYEAAG
AGAGAGASSVPACASWSSSMSADRSLGLRPSRSLDLAVGGGGTDIRISGSVEGEVDELCR
SLGLSGPEEFAIPVAAWEARKERSNSDLLPRSRFVSSPPVDDPSPMARTISAPEVIQCDL
PPSFPASIPEESLNSSSNSTATDSAEEPTAAALGQESPKAAPAVAAVAPLAGLPLLSPKR
GGGEVGIRGARPPVLSPPQPLMALAPPPMRRSIVAKDMSGVSAWDIVNSFAPSEEKSEVR
TDDERVDASHMSDTEEEEEFADEGVAGVDGELKELRIGETFEGFTGTSSLSTTNDDDASS
TTTEAMFIISPNGKFKRKIKSWMRGALLGSGSFGMVYEGISDEGAFFAVKEVSLLDQGSN
AQQSILALEQEIALLSQFEHENIVQYYGTDKEESKLYIFIELVTQGSLSSLYQKYKLRDS
QVSAYTRQILNGLVYLHERNVVHRDIKCANILVHANGSVKLADFGLAKEMSKINMLRSCK
GSVYWMAPEVVNPKKTYGPQADIWSLGCTVLEMLTRNIPYPNVEWTNAFFMIGKGERPQI
PSYLSKDAQDFISQCVQVDPEQRPSASQLMSHPFVNRPLRASFESASPPAISSY
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgttctcgtggagccgtaagcagtcgtcctcctccggccgccgcggcgcggacgcgtcg
tcgatggactccagcagccgcggcggcggaggggaagggagcggaagcgggagccgcggg
cgtagctcgcggctggagcgccgcaacgcggtgaagcacatcgactacgaggcggcgggg
gcgggggcgggggcgggggcgtcgtccgtgccggcgtgcgcgtcgtggtcgtcgtccatg
tcggcggaccggtcgctggggctccggccgtcgcgctcgctcgacctggccgtcgggggc
ggcggcacggacatccgcatcagcggcagcgtggagggggaggtcgacgagctgtgccgc
agcctgggtttatcggggccggaggagttcgcgatccccgtcgccgcatgggaagcccgg
aaagagcgttctaactccgacctactaccgcgctcccgcttcgtctcctcgccacccgtc
gacgacccctctcccatggcccgcaccatttccgcccccgaggtcatccagtgcgacctt
cctccctcattccctgcttcaattcctgaggagtccctcaattcttcctccaattccacc
gcaactgattcggcggaggagcctaccgctgcggcgctcggtcaggaatcccccaaggct
gcccctgccgttgctgctgtggcacccctcgctggattgcccctgctatcgccaaagaga
ggaggcggcgaagtcggtatccgaggagcccgacctcctgtgctctccccgcctcagccg
ctcatggcactcgcaccgccgccaatgaggcgttcaattgtggctaaagacatgagcggg
gtgtcggcttgggatattgtgaactcgtttgctcccagtgaagagaaaagtgaagtgaga
acagatgatgaacgcgtggacgcgtctcacatgtcggacaccgaggaggaggaggagttt
gctgacgagggagtggcaggggtggacggggagctgaaagagttaaggataggagagacc
tttgaagggttcactgggacatcatcattgtcaacaacaaatgatgatgatgcatccagc
acaactacggaggctatgttcatcatctcaccaaatggaaagttcaagaggaagattaag
tcgtggatgcgtggtgctcttctggggagcggctcatttgggatggtgtatgagggcatc
agtgatgaaggagcgttttttgctgtgaaggaagtatctttgcttgaccaaggaagcaac
gcacaacaatctattcttgcacttgaacaggaaattgcactcctaagtcagtttgaacat
gaaaatatagtccagtattatggaactgacaaggaagaatcaaaactgtacatttttatt
gagcttgttacacaaggttctctatcgtccctctatcaaaagtataaactacgagactca
caagtgtcagcatacacaaggcagattctcaacggattggtttatctccatgagcgaaat
gtggttcacagagacattaaatgcgcaaatatactggttcatgcaaatggatcagtaaaa
ttggcagactttgggttggcgaaggagatgtcaaaaattaacatgctgagatcatgcaaa
ggaagtgtttattggatggcacctgaggttgttaatcctaaaaaaacatatgggccccag
gctgatatttggagtcttggctgcactgtattggaaatgcttactcgtaacataccatat
cctaatgtggagtggacaaatgctttttttatgattggaaaaggagaacgacctcaaatt
cccagctatttgtcaaaagatgctcaagatttcattagccagtgtgtacaagttgatcca
gagcaacggccttctgcatcacaacttatgtcacacccatttgttaatagaccgcttcga
gcttcttttgaatctgcatcccctcctgccatcagctcgtattga

DBGET integrated database retrieval system