KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332341
Entry
4332341           CDS       T01015                                 
Name
(RefSeq) anthranilate synthase alpha subunit 2, chloroplastic
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4332341
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     4332341
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Other DBs
NCBI-GeneID: 4332341
NCBI-ProteinID: XP_015631311
UniProt: Q9XJ29
LinkDB
Position
3:complement(8702913..8707788)
AA seq 606 aa
MESIAAATFTPSRLAARPATPAAAAAPVRARAAVAAGGRRRTSRRGGVRCSAGKPEASAV
INGSAAARAAEEDRRRFFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETP
SFLFESVEQGPEGTTNVGRYSMVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIP
RSMMEGWHPQQIDQLPDSFTGGWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLY
DDVLVFDNVEKKVYVIHWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKL
HTRQFGTPLNKSTMTSDEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALR
IVNPSPYMAYVQARGCVLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLL
SDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQS
WDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVF
STAPSHNTMYSYKDTERRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAES
AFVDKE
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagtccatcgccgccgccacgttcacgccctcgcgcctcgccgcccgccccgccact
ccggcggcggcggcggccccggttagagcgagggcggcggtagcggcaggagggaggagg
aggacgagtaggcgcggcggcgtgaggtgctccgcggggaagccagaggcaagcgcggtg
atcaacgggagcgcggcggcgcgggcggcggaggaggacaggaggcgcttcttcgaggcg
gcggagcgtgggagcgggaagggcaacctggtgcccatgtgggagtgcatcgtctccgac
cacctcacccccgtgctcgcctaccgctgcctcgtccccgaggacaacatggagacgccc
agcttcctcttcgagtccgtcgagcaggggcccgagggcaccaccaacgtcggtcgctat
agcatggtgggagcccacccagtgatggaggtcgtggcaaaggagcacaaggtcacaatc
atggaccacgagaagggcaaggtgacggagcaggtcgtggatgatcctatgcagatcccc
aggagcatgatggaaggatggcacccgcagcagatcgatcagctccccgattccttcacc
ggtggatgggtcgggttcttttcctatgatacagtccgttatgttgaaaagaagaagctg
cccttctccggtgctccccaggacgataggaaccttcctgatgttcaccttgggctttat
gatgatgttctcgtcttcgacaatgtcgagaagaaagtatatgtcatccattgggtaaat
cttgatcggcatgcaaccaccgaggatgcattccaagatggcaagtcccggctgaacctg
ttgctatctaaagtgcacaattcaaatgtacccaagctttctccaggatttgtaaagtta
cacactcggcagtttggtacacctttgaacaaatcaaccatgacaagtgatgagtacaag
aatgctgttatgcaggctaaggagcatattatggctggtgatattttccagattgtttta
agccagaggtttgagaggcgaacatacgccaatccatttgaagtctatcgagctttacga
attgtgaacccaagtccatacatggcatatgtacaggcaagaggctgtgtcctggtagca
tctagtccagaaattcttactcgtgtgaggaagggtaaaattattaaccgtccacttgct
gggactgttcgaaggggcaagacagagaaggaagatgaaatgcaagagcaacagctacta
agtgatgaaaaacagtgtgctgaacatattatgcttgtagatttgggaaggaatgatgtt
ggaaaggtctccaaacctggatctgtgaaggtggagaaattaatgaacattgaacgctac
tcccatgtcatgcacatcagttccacggtgagtggagagttggatgatcatctccaaagt
tgggatgccctgcgagccgcgttgcctgttggaacagttagtggagcaccaaaggtgaaa
gccatggagctgatagacgagctagaggtcacaagacgaggaccatacagtggcggcctt
ggagggatatcatttgacggagacatgcttatcgctcttgcactccgcaccattgtgttc
tcaacagcgccaagccacaacacgatgtactcatacaaagacaccgagaggcgccgggag
tgggtcgctcaccttcaggctggtgctggcattgtcgctgatagcagcccagacgacgag
caacgtgaatgcgagaacaaggcagccgctctggctcgagccatcgatcttgctgaatca
gctttcgtagacaaggaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333918
Entry
4333918           CDS       T01015                                 
Name
(RefSeq) anthranilate synthase beta subunit 2, chloroplastic
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4333918
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     4333918
SSDB
Motif
Pfam: GATase Peptidase_C26
Other DBs
NCBI-GeneID: 4333918
NCBI-ProteinID: XP_015630317
UniProt: Q764B9
LinkDB
Position
3:complement(29067753..29071560)
AA seq 273 aa
MATAARLLPKIQSPASPAVAEARRRRPSSLRLGVTSGPARTLKQKLVAKSAVSVVEGENA
FDGVKQDTRPIIVIDNYDSFTYNLCQYMGEVGANFEVYRNDDITVEEIKKISPRGILISP
GPGTPQDSGISLQTVQDLGPSTPLFGVCMGLQCIGEAFGGKVVRSPYGVVHGKGSLVHYE
EKLDGTLFSGLPNPFQAGRYHSLVIEKDSFPHDALEITAWTDDGLIMAARHRKYKHIQGV
QFHPESIITTEGRLMVKNFIKIIEGYEALNCLP
NT seq 822 nt   +upstreamnt  +downstreamnt
atggccaccgccgcgcggctcctccccaagatccagtcccccgcctccccggccgtcgcg
gaggcgcggaggcgccgcccctccagtctccgattaggagttactagtggacccgcaaga
actctgaagcaaaagcttgttgctaagagtgctgtttctgtggtggaaggtgaaaacgca
tttgatggagtaaagcaagatactagaccaatcatagttatagataactacgatagcttc
acgtataatttatgccagtacatgggtgaggtgggagctaactttgaggtgtaccgcaat
gatgatatcaccgtggaagaaattaagaagatttctcctagaggaatactcatctcccct
ggccctggcacacctcaagattcaggaatatcattgcaaacagttcaagatcttggacct
tctacacctttgtttggggtttgcatgggtttgcagtgtattggggaggcatttggaggg
aaggttgttcgttctccttatggagttgtgcatgggaaaggatcccttgttcactatgag
gagaaacttgatggaacactgttttctggtctcccaaacccattccaagcgggaagatac
cacagccttgtaattgagaaggatagcttcccacatgatgccctggaaattactgcttgg
acagacgatgggctgatcatggctgctcgccacaggaagtacaaacatatacagggtgtg
cagttccatccagagagcatcataacaacagaagggaggctcatggtcaagaatttcatc
aagattattgaaggctacgaggccttgaattgcttaccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334640
Entry
4334640           CDS       T01015                                 
Name
(RefSeq) anthranilate synthase alpha subunit 1, chloroplastic
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4334640
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     4334640
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Other DBs
NCBI-GeneID: 4334640
NCBI-ProteinID: XP_015628119
UniProt: Q94GF1
LinkDB
Position
3:complement(34715402..34721077)
AA seq 577 aa
MASLVLSLRIAPSTPPLGLGGGRFRGRRGAVACRAATFQQLDAVAVREEESKFKAGAAEG
CNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGSEGTNVGRYSVVGAQPA
MEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIVEGLPDAFCGGWVGFFS
YDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKKTHVIHWVRVDCHESVD
EAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKSSMSREDYKKAVVQAKE
HILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQARGCILVASSPEILTR
VEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDGKQCAEHIMLVDLGRNDVGKVSKPGS
VKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGTVSGAPKVRAMELIDQM
EGKMRGPYSGGFGGVSFRGDMDIALALRTIVFPTGSRFDTMYSYTDKNARQEWVAHLQAG
AGIVADSKPDDEHQECLNKAAGLARAIDLAESTFVDE
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggccagcctcgtgctctccctgcgcatcgcgccgtccacgccgccgctggggctgggc
ggggggcgattccgcggccgacgaggggccgtcgcctgccgcgccgccacgttccagcag
ctcgacgccgtcgcggtgagggaggaggagtccaagttcaaggcgggggcggcggagggt
tgcaacatcctgccgctcaagcgatgcatcttctccgaccacctcacgccggtgctcgcg
taccgctgcctcgtcagggaggacgaccgcgaggcgcccagcttcctgtttgagtccgtc
gagcagggatccgagggcaccaatgtggggaggtacagtgtggttggggcacagcctgcg
atggagatcgtagccaaggccaaccatgtgactgtcatggatcataagatgaagtctagg
agggagcaatttgcgcctgacccgatgaagataccaaggagcattatggaacagtggaac
ccacagattgttgaaggcctccctgatgcattttgtggaggatgggttggattcttctct
tacgacacagtgcgttatgttgaaacaaagaagcttccattttctaacgcgccagaggat
gataggaaccttcctgacatccatttaggcctctacaatgacatagttgtgtttgatcat
gttgaaaagaaaacacatgttatacattgggtgagggtagattgccatgagtcagttgac
gaagcatatgaggacgggaagaatcagctggaagctttgttatcaagattacatagtgtt
aatgtgccaactcttactgctggttctgtaaaacttaacgttgggcaatttgggtcagca
ctacagaaatcatcaatgtcaagggaggactataagaaagctgttgttcaagcaaaagag
cacattctagctggtgacatttttcaagtagtcttaagccagcgttttgagaggcggaca
tttgctgacccctttgaggtgtaccgtgcattgcgtattgtcaatcctagtccttatatg
gcctatctacaggctcgtggttgtattctggtagcatcaagtcctgaaattcttacccgg
gtggaaaagaggacaattgttaacaggccacttgctggaacaattagaagaggaaaatcg
aaagcagaagacaaagttttagaacaactgctgttgagtgatggaaagcagtgtgctgag
catattatgttagtagatcttggacggaatgatgttggaaaggtgtccaaaccaggttca
gtaaaggtggagaaactgatgaacgttgaacgatattcacatgtcatgcacattagctca
acagttactggagagttgcgtgatgatctgacttgttgggatgctcttcgagcagcattg
cccgttggaacagttagtggtgcaccaaaggtgagagcgatggagctgattgaccagatg
gaagggaagatgcgtgggccgtacagtggtggctttggaggggtttctttccgtggagac
atggacatcgcacttgctctccgtaccatcgtcttccccacgggatctcgcttcgacacc
atgtactcctacactgacaagaatgctcgtcaggagtgggtggctcaccttcaggctgga
gctgggatcgtcgctgacagcaagcctgacgatgagcatcaggagtgcttgaacaaggct
gctggccttgctcgtgccatcgatcttgccgagtctacattcgtagatgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336076
Entry
4336076           CDS       T01015                                 
Name
(RefSeq) anthranilate synthase beta subunit 1, chloroplastic
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4336076
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     4336076
SSDB
Motif
Pfam: GATase Peptidase_C26 KN_motif
Other DBs
NCBI-GeneID: 4336076
NCBI-ProteinID: XP_015636125
UniProt: Q7XUS2
LinkDB
Position
4:complement(23139139..23142814)
AA seq 288 aa
MACSHLAAAAAAASPAAARSPAASSAATASAFARLSATPRVASGGLAVRGQRGVAAVVAA
AAGAAAATPVADIEERRATEKQPIIVIDNYDSFTYNLCQYMGELGLNFEVYRNDELTIED
VKRKNPRGILISPGPGEPQDSGISLQTVLELGPTIPIFGVCMGLQCIGEAFGGKIIRAPS
GVMHGKSSPVRYDEELGKALFNGLPNPFTAARYHSLVIEQETFPHDALEATAWTEDGLIM
AARHKKYRHIQGVQFHPESIITPEGKRIILNFVRFIEELEKQRAGEKN
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcgtgctcccacctggccgccgccgccgccgcggcctccccggcggccgcgcgttca
ccggcggcctccagcgccgcaaccgcgagcgccttcgcgcgcctctcggcgacgccccgg
gtcgcgagcggcgggttggccgttaggggccagaggggtgtagccgctgttgtcgccgcc
gccgccggggccgccgcggcgacgcccgtggccgacatcgaggaacgccgggccaccgag
aagcagcccatcattgtcatcgataactacgacagctttacctacaacctctgccagtat
atgggggagcttggattgaactttgaggtatatcgcaatgatgaacttaccatagaggat
gtaaagaggaagaacccaagaggaatacttatttctccagggcctggtgagccacaagat
tcaggtatatcattgcagactgttctggaacttggacctaccatcccaatttttggtgtc
tgcatgggtctgcagtgtatcggggaagcttttggaggaaagattatccgtgctccttct
ggtgtcatgcatggaaaaagctctccagttcgctacgatgaggagctagggaaggccttg
ttcaatggcttgccaaacccatttaccgctgcaagataccatagcttggtgatcgagcag
gagaccttcccccatgacgctctggaagccaccgcgtggactgaagatggccttatcatg
gctgctcgccacaagaagtacaggcacatccagggagtccaattccacccagagagcatc
atcaccccagaaggcaagaggatcattctcaacttcgtgaggttcatcgaggagctggag
aagcagcgtgccggagagaagaactag

DBGET integrated database retrieval system