KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332348
Entry
4332348           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L4, chloroplastic
  KO
K02926  large subunit ribosomal protein L4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332348
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4332348
  Bacteria
    4332348
SSDB
Motif
Pfam: Ribosomal_L4
Other DBs
NCBI-GeneID: 4332348
NCBI-ProteinID: XP_015628628
UniProt: Q10NM5 Q0DT76
LinkDB
Position
3:8753538..8756027
AA seq 323 aa
MAASSVASTLLLSLSSSSSPFLSPTSVSFLPSAAAAASSSPRVAVAAGKQKAAISVLRAL
RAEAATLPVLSFTGEKVGEVALDLKSAPPSTARAVVHRAIITDRQNKRRGTASTLTRGEV
RGGGRKPYQQKKTGKARRGSMRTPLRPGGGVIFGPKPRDWSIKINRKEKRLAISTALASA
AVADDAFVVEEFDEEFAAGPKTRDFVAALQRWGLDPKEKAMFFATDFADNVRLSGRNIGS
LKMLTPRTLNLYDILDARKLFFTPAAINYLNSRYGATVFDEYEDDTNGEDDGEEEAEELQ
EGEGSAEEAAQDEAAETEADSNS
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgcctcctccgtggcctcgactctcctcctctcgctctcctcttcctcctcgccc
ttcctctcccccacctcggtctccttcctcccatccgccgccgccgccgcctcctcctcc
ccgcgcgtcgccgtcgccgccggcaagcagaaggcggctatctccgtcctccgcgccctt
cgcgccgaggcggccaccctcccggttctctccttcaccggggagaaggtcggggaggtc
gccctcgacctcaagtcggcgccgccctccaccgcgcgcgccgtcgtgcaccgcgccatc
atcaccgaccgccagaacaagcgccgcggcacggcctccacgctcacccgcggcgaggtc
aggggaggcggcaggaagccctaccagcagaagaagacggggaaggcgcggcgcgggtcg
atgcgcacgccgctccgccccggcggcggcgtcatattcgggcccaagccccgcgactgg
tccatcaagatcaaccgcaaggagaagcgcctcgccatctccaccgcgctcgccagtgcc
gccgtggccgacgatgcattcgtcgtggaggagttcgacgaggagttcgccgcgggtccc
aagaccagggacttcgtggccgcgcttcagcggtgggggctcgaccccaaggagaaggcc
atgttcttcgccacggattttgcagacaatgtgcggctcagcggaaggaacattggctcc
ctcaagatgctaacccccaggactctcaacctatacgacatcctcgatgcccgcaagctc
ttcttcaccccggccgccattaactatctcaactccaggtatggtgccaccgtttttgat
gaatatgaggatgataccaatggcgaggatgatggtgaggaggaagcagaggagttgcaa
gaaggagaagggagcgcagaggaggctgctcaagatgaggctgcagagactgaggctgat
agcaattcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350797
Entry
4350797           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L4
  KO
K02926  large subunit ribosomal protein L4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4350797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4350797
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4350797
  Bacteria
    4350797
SSDB
Motif
Pfam: Ribosomal_L4
Other DBs
NCBI-GeneID: 4350797
NCBI-ProteinID: XP_015615460
UniProt: Q2R1Z9 Q0IRY7
LinkDB
Position
11:22139923..22143707
AA seq 286 aa
MRALLRAASVLRRAAAPALGGGRAAPLPPKNLPAVCLNGYSTLLAPANEVLIPQELLSSK
TVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQG
THSTKTISEVSGTGRKPYNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRR
LGLKIALSARTAEGKLLVFDDLEVPSHKTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLA
TQNLHYVNVLPSIGLNVYSILQHDTLVMTRNAINRIVERMHTPISR
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcgggccctcctgcgcgccgcgtcggtgctccgccgcgcggcggctccggccctcggc
ggcggccgcgccgcgccgcttccccccaagaacttgcctgctgtctgtttgaatgggtat
tctactcttttggctccagcaaatgaagtgctgattccacaagaacttctatccagcaag
actgtttggactccagatcgtgagcttgggcagtatgaagacctagtagcccgagtaaca
aacttccacaatgaggataagggcttcatggttttagatggtgatgtttttgatgttcca
atcaggaaggatattgttcatagagtagtaaggtggcaactcgctaaaagacagcaggga
acacactcaactaaaactatcagtgaagtgagcggcacaggaagaaaaccttacaatcaa
aaaggaactggcagagcacgacatggtacactgcgcggccctcagtttcgcggtggtgca
accatgcatgggcctaaaccacgaagtcatgcgattaagttgcagaagaaagtacggcgt
ctgggacttaagatagcattatctgctcgaaccgctgagggaaagctcttggtctttgat
gacctcgaagttcctagccacaagacaaaaaacattgtgcagtacattggccagatggaa
ggcacaaagaaggttttgttggtagatggaggtgacattgataagaagttaaagctggct
acccagaatcttcactatgtgaatgttcttccatccattggcctaaatgtatacagcatc
cttcaacatgacactcttgtaatgacgcggaatgctatcaatagaattgttgagcgtatg
cacacccccatcagccgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352238
Entry
4352238           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L4
  KO
K02926  large subunit ribosomal protein L4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4352238
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4352238
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4352238
  Bacteria
    4352238
SSDB
Motif
Pfam: Ribosomal_L4
Other DBs
NCBI-GeneID: 4352238
NCBI-ProteinID: XP_015619252
LinkDB
Position
12:18303409..18306306
AA seq 210 aa
MQNNKFHNEDKGYMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGIYCLYYFHSILCIYIK
PYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKL
LVFEDLEVPSHKTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLN
VYSILQHDTLVMTRDAVNRIVERMHTPINR
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcagaataacaaatttcacaatgaggataagggctacatggtgttggatggtgatgta
tttgatgttccaatcaggaaggacattgttcatcgagttgtacgttggcaacttgctaaa
cggcaacagggtatttattgtttatattattttcacagtatattatgcatttatataaag
ccttacaagcaaaaaggaactggaagagcacgtcatggaacattgcgtggtccccagttt
cgtggtggtgcaactatgcatggacctaaaccacgaagccatgcaatcaagttgcaaaag
aaggtccgtcgtctgggactgaagatagccttgtctgcacggactgctgaagggaagctt
ctggtctttgaggacttggaagttcctagccacaagacgaagaacgttgtgagctatata
agccagatggaggacacaaagaaagtgctactggttgatggaggcgatatcgataaaaag
ctaaagctggctactcaaaatctccactacgtgaatgtgcttccttcaattggactcaac
gtctacagcatcctccagcatgacaccctcgtaatgactcgcgatgctgtgaatcggatt
gttgagcgaatgcatacccccatcaaccgctag

DBGET integrated database retrieval system