KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332428
Entry
4332428           CDS       T01015                                 
Name
(RefSeq) polyadenylate-binding protein 7
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4332428
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332428
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332428
   03041 Spliceosome [BR:osa03041]
    4332428
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4332428
   mRNA cycle factors
    Stress granule specific factors
     4332428
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4332428
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_3
Other DBs
NCBI-GeneID: 4332428
NCBI-ProteinID: XP_015630119
UniProt: A0A8J8Y2A8 Q10N87
LinkDB
Position
3:9461060..9465402
AA seq 647 aa
MAAQEMEVMMVAMAAEAPVAVEVEAVPAVAGGLNATVPALYVGDLHESVREEHLLEVFGK
IGTLTSVRVCRDNATSNSLRYGYVNYLSQADAAIALEKLNHSLILDKPIRVMWSNRDPDA
RRSGVGNVFVKNLNDLVDNVSLQELFCKFGDILSCKVAKNEDGTSRGYGFVQFALQESAD
ASIQNLNNSHFCGRQLHVATFIKKSERSTNNDDKYTNLYMKNLDDDITEELIKLKFSQYG
LVISVKIMKRDDGTSKGFGFVSFQNPESAKRAKESMNGMLLGSKTLYVARAQKKAERKQY
LQRLHEEKRNEIITKSNGSNVYIKNINDEVGDDALRERFNEFGNITSAKIMRDEKGISKG
FGFVCYNTPEEAKCAVSNMRGVMFYGKPLYVAIAQRKEERRAKLEQRFAELATMVGATSP
VIPTGYPQFYFAHPSTHLPQSPGRQGFMYPPIGISQEWRHNMFPSSHNIQQIHSPIMRNT
PRQYRNNRGRMNGNMMHFHHTVNYVPHAQPAKEFMSMSRQRFSHAKYIPNDIMANGLAIH
HGDSISSMNDAFNNLLATAPPEEQKNMLGNRLYPLVERHHPDLASKITGMLLELGNSEVV
MLLYSSNMLSAKIEECVKLLQEVKPKPEDQEALHPGFLLDSAGVNAN
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggccgcgcaggagatggaggttatgatggttgcgatggcggcggaggcgccggtggct
gtggaggtggaggcggttccggcggtggcgggggggctaaacgcgacggtgcccgcgttg
tacgtgggcgatctccacgaaagcgtgcgggaggagcacctgctcgaggtgttcggcaag
attggcaccctcacgtccgtgcgcgtctgccgcgacaatgccacgagcaactccctcaga
tatggatacgtgaattacctctcccaggctgacgctgcaattgctttggagaaactaaat
catagtcttattttggataagccgatcagagtaatgtggtctaaccgagatccagatgct
aggagaagtggggttggaaatgtgtttgttaagaatcttaatgatttagttgacaatgta
agtctacaagaattattttgcaagtttggagatatattatcttgtaaagtcgctaaaaat
gaggatgggacaagtagaggctatggatttgttcaatttgcgttgcaagaatcagcagat
gcatcaattcaaaatcttaacaactctcatttttgtggcaggcaattgcatgttgctaca
tttattaagaagagtgaacgatctacaaacaatgatgacaaatatactaacctatacatg
aagaaccttgatgatgatataacagaggaacttattaagttaaagttctctcagtatggt
ttagtaattagtgtaaagataatgaaaagagatgatgggacatctaagggctttgggttt
gtaagttttcaaaacccagaaagtgccaaaagagcaaaagaatccatgaacgggatgcta
cttggatcaaaaaccttgtatgtagcaagagctcaaaagaaagctgaaaggaaacaatat
ttgcaacgcttacacgaggagaagagaaatgaaataatcaccaagagcaatgggtcgaat
gtctatataaaaaatattaatgatgaagttggcgacgatgctctccgtgaacggttcaat
gaatttggaaacattacatcagcaaagattatgcgtgatgaaaagggtattagcaaagga
tttggatttgtatgttacaacacacctgaggaagcaaaatgtgctgtaagcaacatgcgt
ggtgtaatgttttatggcaaaccattgtacgttgctattgctcaaaggaaagaggaaaga
cgagccaaactagagcaacgttttgctgagcttgcaacgatggttggagctacaagtcct
gtcatacccacaggatatcctcaattttactttgcccaccctagtacacatctccctcaa
agtccagggagacaaggatttatgtatccacccatagggattagtcaagaatggaggcat
aacatgtttccctcgtcacataatatccaacaaatacattcaccgattatgcgaaatact
ccacggcaatacagaaacaacaggggaaggatgaatggaaatatgatgcattttcaccac
actgtgaactatgttccacatgcgcagccagctaaagaattcatgtccatgtcccgacag
cgatttagccatgctaagtatattccaaatgacatcatggccaatggattggctattcat
catggtgactctatttcatcgatgaatgacgcttttaacaacctgctagctactgctcca
cccgaggaacagaagaacatgcttgggaatagactatatccgttggttgagagacatcat
cctgaccttgccagtaaaatcactggaatgttacttgagctaggtaattctgaagtggtc
atgctactttactcatcaaacatgttgtctgccaaaatagaggagtgtgtcaaactgctc
caagaggtaaaacccaaacctgaagatcaagaggccctgcaccctggtttcctcctagac
tctgctggtgtaaacgccaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336331
Entry
4336331           CDS       T01015                                 
Name
(RefSeq) polyadenylate-binding protein 2
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4336331
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336331
   03041 Spliceosome [BR:osa03041]
    4336331
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4336331
   mRNA cycle factors
    Stress granule specific factors
     4336331
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4336331
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded BRAP2 RRM_8
Other DBs
NCBI-GeneID: 4336331
NCBI-ProteinID: XP_015635554
UniProt: Q7F8Y1 Q0JBX5
LinkDB
Position
4:complement(25194827..25201219)
AA seq 659 aa
MAAQMAAVAVNGGSPGAVTAAAAAGGVGVAVGLGGGGAQSLYVGDLEASVTDSQLYELFS
QAGQVMSVRVCRDISSRRSLGYAYVNFNNPVDAARALELLNFAPLNGKPIRVMYSNRDPS
SRRSGSANIFIKNLDKAIDHKTLHDTFSAFGNILSCKVATDEMGQSKGFGFVQYDKGEAA
QSAIKSLNGMLINDKPVYVGPFLRKQERENSVDKTKFNNVFVKNLSESTTKEDLVKIFGA
YGNITSAVIMVGMDGKSRCFGFINFKSPDDAARAVEELNGKKINDKEWYVGRAQKKSERE
IELKRRFEQSMKDAADKYQGLNLYMKNLDDSIGDDQLCELFSNYGKITSCKIMRDANGVS
KGSGFVAFSTREEASQALTEMNGKMISGKPLYVAFAQRKEDRKAMLQAQFSQVRPVPMTP
SMAPRLPMYPPMAPLGQQLFYGQAPPAIMPPQPGFGFQQQLVPGMRPGGAHMPNYFVPVV
QQGQQGPRPGIRRSGAGSAQGQQSAQPFQQQMLPRGRVYRYPPAHNMPDVPPMPGVAGGM
IQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELLEQNHAAKVT
GMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAALSLGDAIIS
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggcggcgcaaatggcggcggtggcggtgaacgggggctctccgggggctgtcaccgcg
gcggcggcggcgggaggggtcggcgtcgccgtgggcctcgggggcggcggggcgcagtcg
ctgtacgtgggcgacctggaggcgtcggtcacggactcgcagctgtacgagctcttcagc
caggcggggcaggtgatgtcggtgcgcgtctgcagggacatcagctcgcgccgctcgctc
ggctacgcctacgtcaacttcaacaaccccgtggatgctgcaagagcactggagctgctc
aactttgctcctctgaatggcaaacccattcgggtaatgtactcaaaccgtgacccaagc
agtcgcagaagtggatctgctaacattttcatcaagaaccttgacaaagcaatagaccac
aaaactctccatgataccttttctgcatttggtaacattctctcctgtaaggttgccaca
gatgaaatgggccaatccaaaggctttggttttgttcagtatgacaagggagaggctgcc
caatctgcaataaaaagtctaaatgggatgctgatcaatgataagcctgtttatgttgga
ccttttctccgcaagcaagagagagagaattctgttgacaagacaaagtttaacaatgtt
tttgtgaaaaatttgtctgagtccaccacaaaggaggatctagtcaaaatttttggtgcc
tatgggaacatcacaagtgctgttatcatggttggcatggatggtaaatcaaggtgcttt
ggtttcatcaattttaagagcccagatgatgctgctcgtgctgttgaggaacttaatgga
aagaaaattaatgacaaagaatggtatgttggaagagctcagaagaagtcagaaagagag
attgaattgaagagaagatttgagcaaagcatgaaagatgctgctgacaaatatcaagga
ctgaacttatacatgaagaatttggatgatagcattggggatgaccagctttgtgaattg
ttctctaactatggcaaaattacttcatgcaagataatgcgtgatgcaaatggtgttagc
aaagggtctggatttgttgcattttcaactcgtgaggaagcatctcaagctttaactgaa
atgaatggcaaaatgatatctggaaagccattgtatgtcgcatttgcacaacgtaaagaa
gacaggaaggcgatgttgcaggcacaattttctcaggtgcgccctgtaccgatgacacct
tccatggctccacgtcttcccatgtaccctcctatggctcctcttgggcagcaactcttc
tacggacaagctccacctgctatcatgcccccacagcctggatttggtttccagcaacag
cttgttccaggcatgaggcctgggggtgcccatatgccaaattactttgttccagttgtc
caacaaggtcaacagggtccacgtccaggtatccggcgttctggtgctggttctgcccag
ggacagcaatctgctcagccatttcagcaacagatgcttccaagaggacgtgtgtaccgt
tacccacctgcgcataacatgcctgatgttccaccaatgccgggggttgctggtggtatg
attcaatcgtatgatatgggaggcttcccagtacgagatgctggtttgtcacctgctcca
attggaacgctgacttctgcccttgcaaatgctaatccagaacagcaaagaacgatactt
ggtgaaagcctgtatccactggttgagcttctggaacagaaccatgcggccaaggtcacc
ggaatgcttctggagatggatcagacggaggtcctgcatctgctcgagtctccagaggct
ctgaagtccaaggttgctgaggcgatggatgtcctccgcaatgtggcccagcagcacaat
gcgaacaccccgaccagtcaacttgctgcgctgtcactgggcgacgccattatctcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337438
Entry
4337438           CDS       T01015                                 
Name
(RefSeq) multiple RNA-binding domain-containing protein 1
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4337438
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4337438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4337438
   03041 Spliceosome [BR:osa03041]
    4337438
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4337438
   mRNA cycle factors
    Stress granule specific factors
     4337438
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4337438
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded MARF1_RRM1
Other DBs
NCBI-GeneID: 4337438
NCBI-ProteinID: XP_015635038
UniProt: A0A0P0WGS4
LinkDB
Position
4:complement(34832055..34837655)
AA seq 1008 aa
MNPFPHAAAALDPSSVLNAQYKHTHTEGEGDAGSPPNHHHHLHHLLSSRDCYCSTHCLAL
LSPSSNFPLSFYSPPGSNPARCNKPGILNLFFVNQLQAQLRGGKVTLAAQQEGFSDKMNS
GAEYEDGSEEEEPYERVFYDDEDDGNDDSICGDPCDDSVPKEEVHRKLMHEAEPYDDLVA
GEEESVENSALQAFKKERNEQELKQAQKMGYSIKQKEIPVDMEMGMKPFKKRLVKFADDV
SCYTYSTESFAAAKLEKRKAQFDDQDKHLHKKQEHTPPSFPQDGGKLKEVDNTNLYVGNL
PASVGSHKLIELFLPFGQIVRSRVVDDCFTGLSQGYGFVKYSDPRCASEAIKRMNGRLVE
GRALEVRVAGFPSSEDNSQQPSKETDMAKLYVCNLSLSMNTDRLIHLFLPFGEVTNAKVA
KDHTTGLSKGYGFVQYSSPHHAAEAVIHLNGRLVDGRKIEVRVSGIPSTLPNSAVESPST
TRNSAVESPSTTRTVKEIDMSNLYVCNMPSSIDTKKLVELFLPFGKITHARVVADPDTFS
AKGYGFIKFTDSESATKAIAAMNGALVGGEMIIVRVAGLSPSASISAVQTTQDINKSRLY
ITNLPRSMTADKMVNLFAPFGQITKVLMNLEYSLVWYADAPSATKAVQHMDGYMVEGKRL
VVKRSELCTTNASQAGGKPIKEIDMANLYVGRVPSSLTEDQFIDLFRPFGRVVQARMFRF
QRYGMVRFDNPSCAAAAIDHLDGYQIGGSILAVRVAGLPAESNAAKGALTSQMSSNEQGQ
IDMTNLYVSHLPSYVNNERLIDLFLPCGQITQAKVVVERYTGVSKGFGFVKFADAYSAAV
ALTHMNGYPLDGHVLEVRIAGVHPDAMSSYMAHFYSHFTMHDPAKAAVGIPTSYWPHYYD
ESAYNTTAENLGQVTTTSATDASAAQTSQKERLPGSKSVDLVAEKDCSSASNKVANCSES
QPTAWAGPPGFEPHAISKKCTAGSNASQACSKDHFAQSGGGHKRRSIV
NT seq 3027 nt   +upstreamnt  +downstreamnt
atgaatccatttcctcatgctgctgctgctctcgatccatcctcagttctcaacgcacaa
tacaaacacacacacacagagggagagggagacgcagggtcaccacctaatcaccaccac
cacctccaccacctcctctcttctcgggattgttactgctccactcactgcttggccctt
ctctcaccttcttccaacttccccctctccttctactcccctccaggatcgaaccccgcg
cgctgcaacaagcctggcattttgaacctcttctttgtgaaccagttgcaggcacaatta
cgaggtggaaaagtgactttggctgctcagcaggagggtttcagtgacaagatgaattct
ggtgctgaatatgaagatggcagtgaggaagaagaaccatatgaacgtgtgttttatgat
gatgaagacgatggcaatgatgattcaatatgtggggatccctgtgatgattcagtacca
aaagaggaggtgcacaggaagcttatgcatgaagcagagccatatgatgatttggtggct
ggtgaggaggaatctgttgagaactctgctctgcaagctttcaagaaggaacgaaatgag
caagagctcaagcaggcccagaaaatgggttacagcattaagcaaaaggagataccagtg
gacatggaaatgggaatgaaaccgttcaaaaaacggcttgtcaagtttgctgatgatgta
tcatgttacacatacagtaccgagagttttgctgctgcaaagttggagaaaaggaaagct
cagtttgatgaccaggacaagcacctccataagaaacaggaacacactccaccttcgttt
cctcaggatggtggcaagctgaaagaagtggacaacactaatctgtatgtgggcaaccta
cctgcttctgtaggttctcacaagctcatcgagctatttctacctttcggtcaaattgtc
agatcaagagttgtggatgattgtttcactggtttgagccagggatatggctttgtgaag
tattctgatcctcgctgtgcttctgaagctattaagcgcatgaatgggcgcttggttgaa
ggaagagctctagaggtcagagtagctggttttccatcatcagaggataatagccagcag
ccttcaaaggaaactgacatggctaaattgtatgtgtgcaacctttccttgtccatgaac
acagacaggctgattcatctttttctgccttttggggaagtaactaatgcaaaggtggcc
aaagatcacacaacaggcttaagtaaaggatatggctttgtgcagtactctagtcctcac
catgcagctgaggctgtcatccatttgaatggacgtcttgtcgatggaagaaagatagag
gttcgagtatctggcataccttcaacactgccaaattcagctgttgaatcacccagcacc
accagaaattcagctgttgaatcacccagcaccaccagaaccgtcaaggaaattgacatg
tctaatctgtatgtctgtaacatgccatcgtcaattgacaccaagaagttggttgagctt
ttccttccatttggtaagatcacccatgcaagagtggtggcagatcctgacaccttttca
gccaaaggatatggtttcatcaagtttactgattctgaatctgctaccaaagctattgca
gcaatgaatggagcattggttggaggagaaatgataattgtcagagttgcaggcctttcc
ccatcagcatccatctcagctgtacagaccactcaagacatcaacaagtctagactatac
atcactaatcttccacggtcgatgactgccgataagatggttaatcttttcgcgcccttt
ggtcagatcactaaagtcctgatgaatctggagtatagtctagtgtggtatgcagatgca
ccctcagctaccaaagctgtccaacacatggatggatacatggttgaaggaaagaggtta
gtggtcaagagatcagagttatgtacaaccaacgcttcacaagcaggtggcaagccaatc
aaggaaatcgacatggccaatctctatgttggcagggttccatcaagtttaactgaagat
caattcatcgatctcttccgcccatttggacgagttgttcaagctagaatgtttcgattt
cagaggtatggcatggttaggtttgataatccttcatgtgctgctgcagcaattgatcat
ttggatggctaccagattggtggaagcatactggctgtgagagtcgcggggcttccagca
gaatccaatgcagccaagggtgctctgacatcacagatgtcttctaatgagcagggacaa
atcgacatgactaacctttatgtgagccatctcccgagctatgttaacaacgaaagactt
atcgacctcttcctaccatgtggccaaatcactcaagcaaaagtagttgttgagagatac
actggtgtgagcaaaggatttggatttgtcaagtttgctgatgcttactctgctgctgtg
gctctcactcacatgaatggttaccctctggatgggcatgtgttggaggttaggatagct
ggtgttcatccagatgctatgagcagttacatggcgcatttctactcccacttcacaatg
catgatcccgcaaaggcggctgtcggaatacctacgtcctattggccgcactattacgat
gaatccgcatacaatacaacagctgagaacctgggccaagtcaccactacatctgcaacc
gatgcttctgctgctcaaacatctcagaaggaaaggttgcctggatctaaatcagtcgat
ttggttgctgagaaagattgctcttctgcgtcgaacaaagttgccaattgttctgagtca
cagccaacagcttgggctggtccacctggctttgagcctcatgccatctccaagaaatgt
actgctgggtccaatgcttctcaagcttgttcaaaggatcattttgcacagtcaggaggt
ggccacaaaaggcgttcaatcgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341408
Entry
4341408           CDS       T01015                                 
Name
(RefSeq) polyadenylate-binding protein 4-like
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4341408
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4341408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4341408
   03041 Spliceosome [BR:osa03041]
    4341408
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4341408
   mRNA cycle factors
    Stress granule specific factors
     4341408
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4341408
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 RRM_occluded Nup35_RRM
Other DBs
NCBI-GeneID: 4341408
NCBI-ProteinID: XP_015643428
UniProt: Q69X94
LinkDB
Position
6:complement(23136330..23141097)
AA seq 670 aa
MAIPTPSPSVVDQPSPPAPASAAAAASQPLAGDPAPEAAAAAEGAGGDQTAPAAAAATGA
SLYVGDLEASVGEDQLVALFSQVAPVASAYVCRDIAGGRKSLGYGYVNFMSREDATRAME
NLNFTVVNGKPIRVMFSNRDPTLRKSGLANVFIKNLEPNIDNKSLYEMFSSFGTILSSKV
ATDFNGKSKGYGFIQFESESSAKDAINGLNGMLANGQKIFVGLFIRRQEREHTGDANNFT
NVYVKNLPKHFSDNDLLNEFSSFGAITSAIVMRDANGLSRCFGFVNFEKSECARNAVKNL
NGKSIGDMVLYVARAQKKSERQAELKAKFEHDKNQKFEKLQTVNLYLKNLDDDINDEHLR
KLFECFGEVASCKVMLDSHGRSKGCGFVSFATVEDANNAILKMNGKMVGKKPLYVAVAQR
KEERKAFLAAHFARVRALATMAPTLGPNIAPHQFNFGHGVPALFPPPPPAGFGFQPNFVP
NMMMPYNMQRQPGQRSGPPHGGMPRHLHNPHQMFHQNANQGFRHMPNRRNGVANPAMLHQ
HHRFSSPMQPMQQAVKHVVPVGELQAPSNNLQTSLASANPEQQREILGDMLFPLVEQLVN
EKAYKVTGMLLELDKTEVLNLVESPDTLRDKVAEAMKVLELEATATAAAAAAASGSGDGD
AAAPSSSSAA
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcgatccccacgccttcgccatcggtcgtagatcagccgtcccctcccgcgcctgct
tccgccgccgcggcggcgtctcagccgctagccggcgatccggctcccgaggcggcggcg
gcggcggagggggcggggggtgatcagacggccccggcggccgccgccgccaccggcgcg
tcgctgtacgtgggagacctggaggcgagcgtcggggaggaccagctcgtggcgctcttc
tcccaggtggcgcccgtcgcgtccgcctatgtgtgccgcgacatcgccggcggcagaaag
tccttgggatacggctacgtcaacttcatgtcgcgtgaagacgctacccgtgccatggaa
aatctaaacttcaccgttgtcaatgggaagccaatcagagtcatgttttcgaatagggat
ccaactctgcgaaaaagtggacttgccaatgtgtttataaaaaatcttgaaccgaatatt
gacaacaagagtttgtatgaaatgttttcgtcttttggcacaatcctctccagtaaggtt
gccacagatttcaatggaaagtctaagggttatggatttatacaatttgagagcgagtcg
tctgctaaggatgctatcaatggcctaaatggcatgttggctaatggacaaaaaatattt
gttggattgttcatccgccggcaggagagagaacacactggagacgctaacaactttact
aatgtatatgtgaaaaatttaccaaaacattttagtgataacgatttgctaaatgagttt
tcatcatttggtgcaattactagtgctattgtcatgagagatgcaaatggattgtcgaga
tgctttgggtttgtaaactttgagaaatcagaatgtgctagaaatgcagttaaaaatctc
aatgggaagtccattggtgatatggtgttatatgttgcaagggctcagaaaaaatcagaa
agacaagctgagttaaaagcgaaatttgagcatgacaaaaatcagaaatttgagaagctt
caaacagtcaatctatacttgaagaatttggatgatgacatcaatgatgagcatcttagg
aagttgtttgaatgttttggtgaggtagcatcatgcaaggtcatgcttgattcgcatgga
aggagcaagggttgtggatttgtatcttttgcaactgttgaagacgctaacaatgctatt
ttaaaaatgaacgggaaaatggttgggaaaaagccattatatgttgccgtagctcaacgg
aaggaggagagaaaggcatttttagcggcacattttgctcgtgttagagccctagcaaca
atggcacctacattagggccaaacattgctccccatcagttcaattttggccatggtgtg
cctgccttgttcccaccaccaccacctgcaggctttgggttccaaccaaattttgttcca
aacatgatgatgccatataacatgcaaaggcagcctggccagaggagtggtcctccgcat
ggaggaatgcctagacatctgcataatcctcaccagatgtttcaccaaaatgccaaccag
ggcttcagacacatgccaaatcgtaggaatggtgtggccaacccagcaatgttgcatcag
caccatcgcttctctagcccaatgcagccaatgcaacaagctgtcaagcatgtggtgccc
gtgggggaattgcaagctccaagcaataaccttcagacttccttggcttctgcgaacccg
gaacaacaacgagagattcttggcgacatgttgttcccgctcgtcgaacagctggtgaac
gagaaagcttataaggtgactgggatgctgcttgagctggacaagactgaagttctgaac
ctcgtagagtctccagatactctccgggacaaggttgctgaggccatgaaggtgctggag
ttggaggctaccgccaccgccgccgccgccgccgccgcttcaggctccggcgacggcgac
gccgccgcgccgtcctcctccagcgccgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345242
Entry
4345242           CDS       T01015                                 
Name
(RefSeq) polyadenylate-binding protein 2
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4345242
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4345242
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345242
   03041 Spliceosome [BR:osa03041]
    4345242
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4345242
   mRNA cycle factors
    Stress granule specific factors
     4345242
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4345242
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_7 RRM_3 BRAP2
Other DBs
NCBI-GeneID: 4345242
NCBI-ProteinID: XP_015650058
UniProt: Q6Z050 Q0J6I6
LinkDB
Position
8:13471746..13479153
AA seq 660 aa
MAAQVQAVPAAEGGGAPPQANGVVAAGSAAAAAATFQATSLYVGDLDVSVQDAQLFDVFS
QVGSVVSVRVCRDVNTRLSLGYAYVNFSSPADAARALEMLNFTPINGKPIRIMYSNRDPS
SRKSGAANIFIKNLDKSIDNKALYDTFSVFGNILSCKVATEMSGESKGYGFVQFELEEAA
QNAISKLNGMLLNDKKVYVGPFVRKQERENVSGNPKFNNVYVKNLSESTTEDNLKEIFGK
FGPITSVVVMREGDGKSRCFGFVNFENPDDAARAVEDLNGKKFDDKEWYVCRAQKKSERE
MELKEKFEKNIKEAADKNQGTNLYLKNLDDSIDDDEKLKEIFADFGTITSCKVMRDLNGV
SKGSGFVAFKSAEDASRALVAMNGKMIGSKPLYVALAQRKEERRARLQAQFSQMRPMVMP
PSVAPRMPMYPPGVPGVGQQLFYGQPPPAFVNPQPGFGFQQHLIPGMRPSVGPIPNFVMP
MVQQGQQPQRPAGRRAGTGGIQQPMPMGHQQMLPRGSRGGYRYASGRGMPDNAFRGVGGL
VPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAK
VTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLRNAQQQQANTPTDQLAALTLSDGVVS
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcggcgcaggttcaggcggtgccggcggcggagggtggtggcgcgccgccgcaggcc
aacggggtcgtggctgcgggctctgctgccgccgctgcggcgaccttccaggcgacgtcg
ctgtacgtgggggacctcgacgtgagcgtgcaggacgcgcagctgttcgacgtcttcagc
caggtcggatcggtggtatcggtgcgcgtttgccgggacgtcaataccaggctgtcgctg
ggttacgcctatgtcaacttcagcagtcccgccgatgctgcaagggcattggaaatgctg
aacttcactcctattaacgggaagcctatcaggataatgtattctaaccgtgaccccagc
tcacgtaaaagtggagcagcaaacatatttattaagaatcttgacaagtcaatagataac
aaagctctctatgacacattttctgtatttgggaatattctttcgtgtaaagtcgcgacg
gaaatgtctggagagtcgaagggatatggttttgttcagtttgagctggaagaagctgcc
cagaatgctatcagtaagctcaatgggatgcttttgaatgacaaaaaggtgtatgtaggg
ccttttgttcgtaaacaggagagggaaaatgtatcaggcaatcccaaatttaacaatgtg
tatgtaaagaacctatcggaatcaacaactgaagataatttaaaggaaatttttggtaaa
tttggacccataactagtgtcgttgtaatgcgtgaaggtgatgggaaatctagatgcttt
ggatttgttaactttgaaaatccagatgatgctgctcgagctgttgaagatttgaatggc
aagaagtttgatgacaaggaatggtatgtttgtagagcacagaagaagtcagagagggag
atggaattgaaagaaaaatttgagaagaacatcaaagaggcagcagataagaaccaggga
actaacttgtatttgaaaaacttggatgatagcatcgatgacgatgagaaattaaaagaa
atttttgctgattttggtactattacctcttgtaaggtcatgagagatttgaatggtgtt
agtaaaggatctggctttgttgcatttaagtctgctgaagatgcttcacgagctcttgtg
gctatgaatggtaagatgattggcagtaaacctctctatgtagcacttgcacaacgcaag
gaagaaagaagggcaaggcttcaggcacagttctcacaaatgcgtcctatggtgatgcct
ccttcagttgctcctcgtatgcccatgtatccccctggtgtccctggtgtaggccaacag
ctgttttatggccagccacctccagcttttgttaaccctcagcctggatttggcttccag
caacatctcattcctggtatgaggcctagtgttggaccaattccaaattttgtcatgcct
atggtccagcaaggtcaacaaccacaacgtccagctggaaggcgtgcaggcactggtgga
attcagcaaccaatgccaatgggccaccagcaaatgcttccaaggggtagtcgtggtggt
taccgttatgcttctggtcgtggcatgccagacaatgcattccgtggtgttggaggttta
gtgccatccccatatgagatgggaagaatgcctctcagtgatgctggtgcaccaccgcag
gttccaattggagcattggcctctgcactggccaattcacccccagatcagcaaagactg
atgcttggtgaaagtttatacccgcttgttgatcagctggagcatgatcaggcagcgaag
gtcactggcatgcttttggagatggaccagactgaagttctccatctcattgagtcacct
gatgctcttaaggccaaggtcgctgaggctatggaagttctccgtaatgctcagcagcag
caggcaaataccccaactgatcagctagctgctctcaccctgagcgacggcgtcgtttct
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346409
Entry
4346409           CDS       T01015                                 
Name
(RefSeq) polyadenylate-binding protein 2
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4346409
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346409
   03041 Spliceosome [BR:osa03041]
    4346409
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4346409
   mRNA cycle factors
    Stress granule specific factors
     4346409
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4346409
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_7 RRM_3
Other DBs
NCBI-GeneID: 4346409
NCBI-ProteinID: XP_015611898
UniProt: A3BW31 Q6YYV1
LinkDB
Position
9:complement(1213025..1218015)
AA seq 662 aa
MAAAAAQAQAQQAASSASEGGSPASSAAAAAAAAASFPATSLYVGDLDVSVQDAQLFDVF
AQVGGVVSVRVCRDVNTRRSLGYAYVNYSSPADAARALEMLNFTPINGKPIRIMYSNRDP
SLRKSGTANIFIKNLDKSIDNKALYDTFCVFGNILSCKVATDASGESKGYGFVQYERDEA
AQAAIDKLNGMLMNDKKVYVGPFIRKQERDNSPGQVKFNNVYVKNLSENTTEDDLKEIFG
KFGTITSAVVMREGDGRSKCFGFVNFESPDDAAQAVQELNGKKFDDKEWYVGRAQKKSER
EMELKEKFEKNLQEAADKYQNTNLYLKNLDDSVDDDKLRELFAEYGTITSCKVMRDSNGV
SRGSGFVAFKSAEDASRALAEMNSKMVGSKPLYVALAQRKEDRKARLQAQFSQLRPVPLA
PSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINTQPGFGFQQPLMPGMRPGAGPMPNFIMP
MVQQGQQPQRPAGRRAGAGGMQQPMPMGQQQMMARGGRGYRYPTGRGMPDPAMHGVGGGV
MPSPYEMGGMPMRDAAASQPVPIGALATALANAAPDQQRMMLGENLYPLVDQLEHEQAAK
VTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTAQQIQTNATPEQQLASLSLNDGVV
SS
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgcaggcgcaagcgcagcaggcggcgagctccgcgtccgagggc
gggtccccggcctcctccgccgcggccgctgcggcggcggccgcctccttcccggcgacc
tcgctctacgtcggggatctcgacgtcagcgtgcaggacgcgcagctcttcgacgtcttc
gcgcaggtcggcggcgtcgtctccgtgcgcgtctgcagggacgtcaacacgcggaggtcg
ctcggctacgcctacgtcaactacagcagccccgccgatgctgcacgagcgttggaaatg
ctcaacttcactcctatcaatggaaaacctatcaggatcatgtattctaaccgtgacccc
agcttgcgcaagagtggcacagcaaatatttttatcaagaaccttgataagtcgatagac
aacaaagctttgtatgatactttctgtgtgtttggaaacattctttcatgtaaagttgca
acagatgcttctggagaatcgaagggctatggctttgttcagtatgagcgggatgaggca
gctcaagctgctattgataaactcaatggcatgcttatgaatgacaaaaaggtgtatgtt
gggcctttcattcgtaagcaggagagggataattctccaggccaggtcaagttcaataat
gtctatgtaaagaacctgtctgagaatactactgaagatgacttgaaggaaatctttgga
aaatttggaaccatcactagcgctgttgtaatgcgtgagggagatggaagatccaagtgt
tttggatttgttaactttgaaagtccagatgatgctgctcaggctgtccaagagctgaat
ggcaagaagtttgatgataaggaatggtatgttggaagggcacaaaagaaatcggaaaga
gagatggaattgaaagagaaatttgagaagaaccttcaagaagcagcagataagtatcaa
aacactaacctgtacctgaagaacttggatgatagtgttgatgatgataagttgagggag
ctttttgctgagtatggcactattacttcctgcaaggtgatgcgggattcaaatggtgtc
agcagaggttctggatttgttgcgtttaaatctgctgaagatgcttcccgagctcttgcc
gaaatgaacagcaagatggttggcagcaaaccgctctacgttgcgcttgcacagcgcaag
gaagacaggaaagcaaggctgcaggcacaattttcacaactgaggcctgtcccacttgct
ccttcagttggtcctcgcatgcccatgtttccacctggtgttcctggagttggacagcaa
ctgttctatggtcagccccctccagcgtttatcaacacacagcctggtttcggcttccag
cagcctcttatgcctgggatgaggccaggtgcaggtccaatgccgaactttatcatgcct
atggttcagcaaggacaacagccgcagcgtccggctggtaggcgtgctggtgctggtgga
atgcagcaacccatgccaatgggtcagcaacagatgatggctaggggcggccgtggctat
cggtatcctacaggacgtggcatgcctgatcctgcaatgcatggtgttgggggtggtgtg
atgccatctccatatgagatgggaggcatgcccatgagagatgctgctgcgtcacagcct
gtacctattggagcattggctactgcactggccaacgcagcccctgatcagcaaagaatg
atgcttggtgagaacttgtatcctcttgttgatcagctggagcatgagcaggctgcgaag
gtgactggcatgctgctggagatggaccagactgaggtgctgcacctgctcgagtctcca
gaggctctcaaggccaaggttgctgaagccatggaggtccttcgcacggcccagcagatc
cagacgaacgcgacgcctgaacagcagcttgcttctctgtcgctgaatgacggcgtcgtt
tcctcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346605
Entry
4346605           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein 2, chloroplastic
  KO
K13126  polyadenylate-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4346605
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346605
   03041 Spliceosome [BR:osa03041]
    4346605
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4346605
   mRNA cycle factors
    Stress granule specific factors
     4346605
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Complex C specific factors
    4346605
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 TC1
Other DBs
NCBI-GeneID: 4346605
NCBI-ProteinID: XP_015610679
UniProt: A0A0P0XKA8 Q6H443
LinkDB
Position
9:complement(5870960..5873197)
AA seq 245 aa
MATTTTTTISSSLITPPAAALHHRSSSCRCPSRLTVGAARWWARRRQPAVVVRVVASSSV
LEAPEEVAARKLYVGNIPRTVTNDELAAMFADHGTVERAEVMFDKYTGRSRRFGFVTMST
PEEANAAIESLNETEVGGRKIKVNVTESFLPNIDRSAPEPEPVFVDSQYKVYVGNLAKSV
TTEMLKNFFSEKGEVLSATVSRIPGTAKSKGYGFVTFSSEEEVQAAVSTFNNAELEGQPI
RVNKA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcgaccaccaccaccaccaccatctcctcctccctcataacccctccggccgcggcc
ctccaccaccgcagcagctcctgccggtgcccctcccgcctcaccgtcggggccgcgcgg
tggtgggcgaggcgccggcagccggcggtggtggtgcgggtggtcgcctcctcgtcggtg
ctcgaggcgcccgaggaggtggcggcgcggaagctctacgtcgggaacatccccaggacc
gtcaccaacgacgagctcgccgccatgttcgccgaccacggcaccgtcgagcgcgccgag
gttatgtttgacaaatacactggccggagtaggcgcttcgggtttgtcacgatgagcaca
ccggaggaggctaatgctgcaattgagagcctgaatgaaactgaggtcggtggtagaaaa
attaaggttaatgtgacggagagcttcttgcctaacattgatcggtctgcaccagaacca
gagcctgtatttgtggacagtcagtacaaggtttacgttggtaatcttgcaaagagcgtg
accacagagatgcttaaaaacttcttctctgaaaagggagaggttctcagtgccaccgtg
tcccggattccaggaactgcaaagtccaagggatatggttttgtcaccttttcttcagag
gaagaagttcaggctgcagtttctactttcaacaatgcggaattggaaggacaacccatc
cgtgtgaataaagcatag

DBGET integrated database retrieval system