KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332460
Entry
4332460           CDS       T01015                                 
Name
(RefSeq) cardiolipin synthase (CMP-forming), mitochondrial
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4332460
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     4332460
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 4332460
NCBI-ProteinID: XP_015630365
LinkDB
Position
3:complement(9733198..9737602)
AA seq 372 aa
MRVRKRNSSLLLLPRPPHLSPQPAAQTRGNRPINPSINQPIRPMPPSVATHASLLLKAAA
AAAHLHPKPFFSPRAAPPRIPSAPAPPAAGGSRYRPTTTTTAAATATSATAACRWFRWPP
PAQAPVRGLCSLPHSGGGGGGGEGMGSEGVGRRRRVVAPAVNGVAKDGAPQPPPPKLLTL
PTVLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWLDGYIARKMQLGTPFGAF
LDPVADKLMVAATLVLLCTKPLEISLLRDGPWLLTVPAIAIIGREITMSAVREWAASQNT
KVLEAVAVNNLGKWKTATQMTALTILLASRDKSLPAQDALVTSGIALLYVSAGLAIWSLV
VYMRKIWRILLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgcgagtgcgtaagcgtaactcctccctcctcctcctcccacgtcccccgcacctttcc
ccccaacccgcagcccaaacaagagggaatcgaccaatcaatccatcaatcaatcaaccg
atccgacccatgcccccatccgtcgccacccacgcatccctcctcctcaaagccgccgcc
gcagccgcgcacctccaccccaagcccttcttctccccacgcgcggcgccgccgcggatc
ccgtctgcccccgcgccgccggccgcaggaggcagccgctaccgtccgacgacgacgacg
acggcggcggcgacggcgaccagcgccaccgccgcgtgccgctggttccggtggcccccg
cccgcgcaggcgcccgtgaggggtctgtgctccttgccgcattctggcggtggcggtggt
ggtggtgagggtatgggatctgaaggggtcgggaggaggaggcgggtggtggcgcctgcg
gtgaacggggtggcgaaggacggggcgccacagccgcctccgcccaagctgctcacgctg
cccaccgtgctcaccattggccgcgtcgccgccgtgccgctcctgataagcactttctac
atggaggggccttgggcagcaactgcgacaactggcatcttccttgctgctgcagtcact
gattggctagatggttatattgcgagaaagatgcagttaggaacaccttttggtgcattt
cttgatcctgtggctgacaagcttatggtagctgcaacattagtgttgctgtgcaccaaa
cctttggaaatttcactgctcagagatgggccatggcttctaacggttcctgccattgct
attattgggagagagatcacaatgtcagctgtgagagaatgggctgcgtctcagaatacc
aaagttcttgaggctgtggcagttaacaatttggggaagtggaagaccgcaacgcagatg
acagcattgactatcctccttgcgagcagagacaaaagtcttcctgcacaagatgctctg
gttacttccggcatcgcattgctttatgtatcagctggacttgccatatggtccctagtg
gtgtacatgagaaagatatggcggatacttctaaaatag

DBGET integrated database retrieval system