KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332464
Entry
4332464           CDS       T01015                                 
Name
(RefSeq) two-component response regulator-like PRR73
  KO
K12129  pseudo-response regulator 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4332464
SSDB
Motif
Pfam: Response_reg CCT
Other DBs
NCBI-GeneID: 4332464
NCBI-ProteinID: XP_015630696
UniProt: Q10N34 B9F7P0
LinkDB
Position
3:complement(9759583..9768679)
AA seq 767 aa
MGSACEAGTDEPSRDDVKGTGNGILENGHSHKPEEEEWRNGMGEDLPNGHSTPPEPQQTD
EQKEHQVQIVRWERFLPVKTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCL
EDLQNHIDLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAV
DFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIRTQKCTKPKVDDEYENNSGSNNDNE
DDDDNDEDDDDLSVGHNARDGSDNGSGTQSSWTKRAVEIDSPQQMSPDQPSDLPDSTCAQ
VIHPTSEICSNRWLPTANKRSGKKHKENNDDSMGKYLEIGAPRNSSMEYQSSPREMSVNP
TEKQHETLMPQSKTTRETDSRNTQNEPTTQTVDLISSIARSTDDKQVVRINNAPDCSSKV
PDGNDKNRDSLIDMTSEELGLKRLKTTGSATEIHDERNILKRSDLSAFTRYHTTVASNQG
GAGFGGSCSPQDNSSEALKTDSNCKVKSNSDAAEIKQGSNGSSNNNDMGSSTKNAITKPS
SNRGKVISPSAVKATQHTSAFHPVQRQTSPANVVGKDKVDEGIANGVNVGHPVDVQNSFM
QHHHHVHYYVHVMTQQQQQPSIERGSSDAQCGSSNVFDPPIEGHAANYSVNGSFSGGHNG
NNGQRGPSTAPNVGRPNMETVNGIVDENGAGGGNGSGSGSGNDLYQNGVCYREAALNKFR
QKRKVRNFGKKVRYQSRKRLAEQRPRIRGQFVRQSGQEDQAGQDEDR
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgggtagcgcctgcgaagctggtacggacgagccttcccgagacgatgttaaggggaca
gggaatggcatcctggagaatggtcatagtcacaagccagaggaggaggaatggaggaat
ggcatgggagaggacttacccaatgggcacagtacaccaccagagccccagcaaacagat
gaacagaaggagcaccaagtgcagattgtccggtgggagaggttcctccctgtgaagaca
ctgagggtcttgctggtggagaatgatgactctacccgtcaggtggtcagcgcactgctt
cgtaagtgttgttatgaagttatccctgctgaaaatgggctacatgcatggcaatgtctt
gaagatctgcaaaaccacattgaccttgtattgaccgaggtcgtaatgccacgtctgtct
ggcattggtctgcttagtaagatcacaagccacaaaatttgcaaggatattcccgtgatt
atgatgtcttcgaatgactcaatgggtacagtctttaagtgtttgtcaaaaggagcagtt
gactttctagtgaagcctatacgtaagaatgaacttaagaacctttggcagcatgtttgg
agacgatgccacagttccagtggcagtggaagcgaaagtggcatccgaacacaaaagtgt
accaaaccaaaggttgatgatgaatatgagaataacagcggtagcaataatgacaacgag
gatgatgatgacaatgatgaagatgatgacgacttaagtgttggacacaacgctagggat
ggcagtgataatggcagtggcactcaaagttcatggacaaagcgtgcagtggagattgac
agcccacaacaaatgtctcctgatcaaccatccgatctaccagatagtacttgtgcgcaa
gtaattcaccccacatcagagatatgcagcaacaggtggttaccgactgcaaataaaagg
agcggaaagaaacataaagaaaataacgatgactccatggggaagtacttagaaatagga
gctcctagaaattctagtatggagtaccaatcttctccaagagagatgtccgttaatcca
acagaaaaacagcatgaaactctcatgccccaaagtaaaacaacaagagaaacagatagt
aggaacacacagaatgaaccaactactcaaactgttgatttaattagttcaatagccaga
agcacagatgacaaacaagtagttagaatcaataatgctcctgattgctcctccaaggtt
ccagatggaaatgataaaaatcgtgattctctcattgatatgacatctgaagagttgggt
ttgaagagattgaaaacaactggatctgcaactgaaatccatgatgaacgaaatattctg
aaaagatcagatctctcagctttcaccaggtaccatacaactgtggcttctaatcaaggt
ggagctggatttgggggaagctgttcacctcaagataacagttcagaggctctgaaaaca
gactccaactgcaaggtgaagtcaaattcagatgctgctgaaataaagcaaggctccaat
ggtagtagcaacaacaatgacatgggctccagtactaagaatgccatcacaaaaccttct
tcaaacaggggaaaagtgatatcaccatcagctgtcaaagctacccaacatacatcagca
ttccatcctgtgcagcgtcaaacgtcacctgctaatgttgtagggaaagacaaagttgat
gaaggaattgctaatggagttaatgtgggccaccctgtagatgtacaaaatagctttatg
cagcaccatcatcatgttcattactacgtccatgttatgacacagcagcagcagcagcca
tccattgagcgaggatcatcagatgctcagtgtggttcatccaatgtatttgatcctccc
attgaaggtcatgcggcaaactatagtgtgaacgggagcttttcaggtggccataatgga
aacaatgggcaaagaggacctagtactgctcccaatgttgggaggccaaacatggagact
gttaatggtatcgtggatgaaaatggggctggaggtggcaatggaagtgggagcggtagt
ggtaatgacttgtatcagaatggggtctgttaccgagaagctgcattgaacaaattcaga
cagaaacggaaagtgaggaactttggaaaaaaggtgcgctatcagagcagaaagaggttg
gctgagcagcgccctcggatccgcgggcaattcgtgcgacaatctggacaggaagatcag
gcaggccaagacgaagacagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344399
Entry
4344399           CDS       T01015                                 
Name
(RefSeq) two-component response regulator-like PRR37 isoform X1
  KO
K12129  pseudo-response regulator 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4344399
SSDB
Motif
Pfam: Response_reg CCT
Other DBs
NCBI-GeneID: 4344399
NCBI-ProteinID: XP_015646601
UniProt: Q0D3B6
LinkDB
Position
7:29616704..29629187
AA seq 742 aa
MMGTAHHNQTAGSALGVGVGDANDAVPGAGGGGYSDPDGGPISGVQRPPQVCWERFIQKK
TIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEDMQNSIDLVLTEVVMPGV
SGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHV
WRRCHSSSGSGSESGIQTQKCAKSKSGDESNNNNGSNDDDDDDGVIMGLNARDGSDNGSG
TQAQSSWTKRAVEIDSPQAMSPDQLADPPDSTCAQVIHLKSDICSNRWLPCTSNKNSKKQ
KETNDDFKGKDLEIGSPRNLNTAYQSSPNERSIKPTDRRNEYPLQNNSKEAAMENLEESS
VRAADLIGSMAKNMDAQQAARAANAPNCSSKVPEGKDKNRDNIMPSLELSLKRSRSTGDG
ANAIQEEQRNVLRRSDLSAFTRYHTPVASNQGGTGFMGSCSLHDNSSEAMKTDSAYNMKS
NSDAAPIKQGSNGSSNNNDMGSTTKNVVTKPSTNKERVMSPSAVKANGHTSAFHPAQHWT
SPANTTGKEKTDEVANNAAKRAQPGEVQSNLVQHPRPILHYVHFDVSRENGGSGAPQCGS
SNVFDPPVEGHAANYGVNGSNSGSNNGSNGQNGSTTAVNAERPNMEIANGTINKSGPGGG
NGSGSGSGNDMYLKRFTQREHRVAAVIKFRQKRKERNFGKKVRYQSRKRLAEQRPRVRGQ
FVRQAVQDQQQQGGGREAAADR
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgatgggaaccgctcatcacaaccaaaccgccggctctgccctcggagtcggagtcgga
gatgccaacgacgccgtgcctggggctgggggtgggggctacagcgacccggatggcgga
ccaatctccggtgtgcagcggccaccgcaggtctgctgggagcgcttcatccagaagaag
actatcaaagtcttgctagttgatagcgatgactccaccaggcaggtggtcagtgccctg
cttcgtcactgcatgtatgaagtcatccctgctgaaaatggccagcaagcatggacatat
ctagaagatatgcaaaacagcattgatcttgttttgacagaggttgttatgcctggtgta
tctggaatttctctattgagtaggatcatgaaccacaatatttgcaagaatattccagtg
attatgatgtcttcaaatgatgctatgggtacagtttttaagtgtttgtcaaagggcgct
gttgacttcttagtcaagcccatacgtaagaatgaacttaagaacctatggcagcatgtg
tggagacggtgccacagctccagtggcagtggaagtgaaagtggcattcagacacaaaag
tgtgccaaatcaaaaagtggggatgaatccaataataacaatggcagcaatgacgatgat
gacgacgatggtgtaatcatgggacttaatgcaagagatggcagtgataacggcagtggc
actcaagcgcagagctcatggacaaagcgcgctgttgagattgacagtccacaggctatg
tctccagatcaattagctgatccacctgatagcacttgtgcacaagtgatccacctgaag
tcagatatatgcagcaatagatggttaccatgtacaagcaacaaaaattccaagaaacaa
aaagaaactaatgatgacttcaaggggaaggacttggaaataggttctcctagaaattta
aacacagcttatcaatcctctccgaatgagagatccatcaaaccaacagatagacggaat
gaatatccactgcaaaacaattcaaaggaggcagcgatggaaaatctggaggagtcaagt
gttcgagctgctgacttaattggttcgatggccaaaaacatggatgcacaacaggcagca
agagccgcaaatgcccctaattgctcctccaaagtgccagaagggaaagataagaaccgt
gataatattatgccatcacttgaattaagtttgaaaaggtcaagatcgactggggatggt
gcaaacgcaatccaagaggaacaacggaatgttttgagacgatcagatctctcggcattt
acgaggtaccatacacctgtggcttccaatcaaggtgggacaggattcatgggaagctgt
tcgctgcatgataatagctcagaggctatgaaaacggattctgcttacaacatgaagtca
aactcagatgctgcaccaataaaacaaggttctaatggtagtagcaataacaatgacatg
ggttccactacaaagaacgttgtgacaaagcctagtacaaataaggagagagtaatgtca
ccctcagctgttaaggctaatggacacacatcagcatttcatcctgcacagcactggacg
tctccagctaatacaacaggaaaagaaaagactgatgaagtggctaacaatgcagcaaag
agggctcagcctggtgaagtacagagcaacctcgtacaacaccctcgcccaatacttcat
tatgttcatttcgatgtgtcacgtgagaatggtggatccggggcccctcaatgtggttca
tccaatgtatttgatcctcctgtcgaaggtcatgctgccaactatggtgtcaatggaagc
aactcaggcagtaacaatggaagcaatgggcagaatgggagtacgactgctgtaaatgct
gaacggccaaatatggagatcgctaatggcaccatcaacaaaagtggacctggaggtggc
aatggaagtggaagcggcagtggcaatgacatgtatctgaaacgcttcactcaacgagag
catagagtggctgcagtgatcaagtttagacagaaaaggaaagagcgcaacttcggaaaa
aaggtgcggtaccagagcagaaagaggctggccgagcagcggccaagggtccgcggacag
ttcgtgcggcaagctgtgcaagaccaacaacagcagggtggtgggcgcgaagcggcagcg
gacagatga

DBGET integrated database retrieval system