KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332466
Entry
4332466           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L10, chloroplastic
  KO
K02864  large subunit ribosomal protein L10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332466
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4332466
  Bacteria
    4332466
  Archaea
    4332466
SSDB
Motif
Pfam: Ribosomal_L10
Other DBs
NCBI-GeneID: 4332466
NCBI-ProteinID: XP_015628498
UniProt: Q10N30 A0A8J8Y8Q7 Q9ZSS9
LinkDB
Position
3:complement(9781528..9782585)
AA seq 220 aa
METSSFLRTTLPTAKPLPAFQTLAPRPRPRPLRRSTISAAITRGRKEDTVAAVREQLEGC
YLLAGIRYEGLTVKQLQGIRDTLPETCRLLVAKNTLVGKAIEGTPWEALKPCMKGMNAWL
FVHTEEVPAALKPYRAFQKEERLEETNDFVGAVFEGKFYAPGDFKALETMPSRAEVYAKL
LGSLQGPATSVVTTLQAPARDVVSVLSAYVRKLEQEVGAA
NT seq 663 nt   +upstreamnt  +downstreamnt
atggagacctcctccttcctccgcaccaccctccccaccgcgaagcccctcccggcgttc
cagaccctcgcaccccgcccccgcccccgcccgctccgccgctccaccatcagcgcggcc
atcacccgaggccgcaaggaggacacggtggccgccgtccgcgagcagctggagggctgc
tacctcctcgccgggatccgctacgagggcctcacggtgaagcagctgcagggcatccgc
gacaccctcccggagacctgccggctgctggtggcgaagaacacgctggtggggaaggcc
atcgagggcacgccgtgggaggcgctcaagccgtgcatgaaggggatgaacgcgtggctg
ttcgtccacaccgaggaggtccccgccgcgctcaagccctaccgcgccttccagaaggag
gagcgcctcgaggagaccaacgacttcgtcggcgcggtgttcgagggcaagttctacgcc
cccggggacttcaaggcgctcgagacaatgcccagccgcgccgaggtgtacgccaagctg
ctcggctcgctgcaggggcccgcgacctccgtcgtcaccacgctgcaggcgccggccagg
gacgtcgtctccgtgctctcggcgtacgtgcgcaagctcgagcaggaggtcggcgccgcc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337653
Entry
4337653           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L10, chloroplastic
  KO
K02864  large subunit ribosomal protein L10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337653
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4337653
  Bacteria
    4337653
  Archaea
    4337653
SSDB
Motif
Pfam: Ribosomal_L10
Other DBs
NCBI-GeneID: 4337653
NCBI-ProteinID: XP_015637998
UniProt: B9FGK0 Q60F44
LinkDB
Position
5:complement(1146189..1147119)
AA seq 191 aa
MTSVRAVGSTLPSIRAAAELARQELLRRELVECQLVAGIWCHGFTVSQLRSIRASLPPTA
RLVVAKNSDVAAAVAGTRWEAVRPFARGMNAWLFVRSDEIPPALRPYRDFQKEWKLQLND
FTGAVFEGRLYSPDDFAQLESMPTRVQSYQYLVGCLQMPAVSVLAALRARQEAMAQPPPA
DEPAPTPPADK
NT seq 576 nt   +upstreamnt  +downstreamnt
atgacgtccgtgcgcgccgtggggtccacgctgccgtcgatccgcgcggcggcggagctg
gcccggcaggagctgctgcggcgggagctggtggagtgccagctggtggcgggcatctgg
tgccacgggttcacggtgtcgcagctgcggagcatccgcgccagcctgccgccgacggcg
aggctggttgtggcgaagaactcggacgtggcggcggcggtggccgggacgcggtgggag
gcggtgcggccgttcgcgcgggggatgaacgcgtggctgttcgtccgctccgacgagatc
ccgccggcgctgcggccgtaccgcgacttccagaaggagtggaagctgcagctcaacgac
ttcactggcgccgtcttcgagggccgcctctacagccccgacgacttcgcgcagctcgag
tccatgcccaccagggtccagtcctaccagtacctcgtcggctgcctccagatgcccgcc
gtctccgtcctcgccgcgctccgcgctcgccaggaggccatggcgcagccgccgcccgcc
gacgagccggctccaacgccaccggcggacaagtga

DBGET integrated database retrieval system