KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332477
Entry
4332477           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 2, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4332477
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4332477
    4.2.1.91  arogenate dehydratase
     4332477
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 4332477
NCBI-ProteinID: XP_015630989
UniProt: Q10N17 Q0DSV2
LinkDB
Position
3:9863847..9868778
AA seq 399 aa
MDSTACLRLPFLPARTRPSSSSSSSPRRAARASSIKCCTAASDAGASSASISSASPRRPD
VVNGVGPAGVDGLAGPPVPVPDSPAPASRDLHWLPRPLTSADLMGVSGEGLKVAYQGCPG
AYSEAAAKKAYPNCQTVPCEHFDTAFKAVENWLADRAVLPLENSLGGSIHRNFDLLLRHR
LHIVGEVRLAVRHCLLANPGVKIENLKSAMSHPQALAQCEHTLTEFGIEHREAVDDTAGA
AKTVAEQNLQDTGAIASSLAAELYGLNVLAENIQDDKDNVTRFMMLAREPIIPRTDKPFK
TSIVFSLEEGPGQLFKALGVFALREINLTKIESRPHKKRPLRITDDSFSTPSKQFDYLFY
MDLEASMADPKTQNALGNLKEFATFLRVLGSYPTDVNEA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggattccacggcctgcctccgcctcccgttcctccccgcccggacccgcccctcctcc
tcctcctcgtcgtctccccgacgcgccgctcgcgcgtcctccatcaaatgctgcaccgcc
gcctccgacgccggtgccagttcggcctccatctcttccgcgtcgccgcggcggccggac
gtggtgaacggcgtggggcccgccggcgtagacggcctcgcgggtccgcccgtgcccgta
ccggactcccccgcccccgcctcccgtgatctccactggctgcctcgccctctcaccagc
gccgacctgatgggcgtcagcggggaggggctcaaggttgcctaccagggttgccctgga
gcgtacagcgaggcggcagcgaagaaggcgtacccaaattgccagactgtgccctgtgag
cacttcgatactgcattcaaggctgttgaaaactggttagctgacagggcagtattgcca
cttgagaattcattgggtggtagcatacataggaactttgaccttttacttcgtcataga
ttgcacattgttggagaggtccgtcttgctgttcgtcattgcctgttagccaatcccggt
gtcaagattgaaaacttgaaaagtgcaatgagccatccccaggctcttgcacaatgtgag
cacacattgacagagttcggaattgaacatagagaagctgttgatgatactgctggtgca
gcaaagactgtagcagaacaaaatctccaagataccggtgcgattgccagttcactggca
gctgaactttatggactgaatgttcttgctgaaaatattcaggatgacaaagataatgtt
acccgttttatgatgctggctcgagaaccaattatacctcgcaccgataaaccattcaag
actagcatagtcttttcacttgaagaaggacctgggcaactctttaaggcacttggggtg
tttgcactgagggaaatcaacctaaccaagatagaaagccgcccacacaagaaaaggcct
cttcgtataactgacgacagcttttccacaccgtcaaagcagtttgactacctcttctat
atggaccttgaggcatcaatggctgatccaaaaactcagaatgctcttggaaatttgaag
gagtttgcaacctttttaagagtccttggaagctatcctacagatgtaaatgaagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335756
Entry
4335756           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4335756
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4335756
    4.2.1.91  arogenate dehydratase
     4335756
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 4335756
NCBI-ProteinID: XP_015637196
UniProt: Q0JDF7 A0A0P0W9W4
LinkDB
Position
4:20169574..20171239
AA seq 436 aa
MAAASLIKAPVGQNPARMGAGRSSGGGGVVRCSLQGAVVGGRAEWQSSCAVLSSKVAALG
AASPHAAAPSFVNGHVAPLVPEQQAAAEDGGAVLDLVPVSSVNGGGVAKNLPQPLRISDL
SPAPMHGSQLRVAYQGVPGAYSEKAAGKAYPGCDAIPCDQFEVAFSAVELWIADRAVLPV
ENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLMALPGVRKECLTRVMSHPQALAQCEH
TLTAMGLNVVREAFDDTAGAAEYVAANGLRDTAAIASSRAAELYGMEVLADGIQDDCGNV
TRFVMLAREPIVPRTDRPFKTSIVFAHDKEGTSVLFKVLSAFAFRDITLTKIESRPHRHR
PIRLVDDANVGTAKHFEYMFYVDFQASLAEPRAQNALAEVQEYTSFLRVLGSYPMDMTPM
TAGSSSTVTSDDSSST
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggccgcggcgagtttgatcaaggcgcccgtggggcagaatcctgcgaggatgggcgcg
gggaggagcagcggaggaggaggggtggtcaggtgctcgctgcagggcgccgtggtgggc
ggccgggcggagtggcagagcagctgcgccgtgctgtccagcaaggtggccgcgctcggg
gcggcgtccccgcacgccgcggcgccaagcttcgttaatgggcatgtcgcgccgctggtc
ccggagcagcaggcggcggcggaggacggcggggcggtgctggatttggtgcccgtgagc
agcgttaatggcgggggcgtcgccaagaacctgccgcagccgctgcggatctcggatctg
tcgccggcgccgatgcacgggtcgcagctgcgcgtggcgtaccagggcgtccccggtgcg
tacagcgagaaggcggccgggaaggcgtacccgggctgcgatgccatcccctgcgaccag
ttcgaggtggcgttctcggccgtggagctgtggatcgccgaccgcgccgtgctccccgtg
gagaactcgctgggcggcagcatccaccgcaactacgacctcctgctcaggcaccggctc
cacatcgtcggcgaggtgcagctccccgtgcaccactgcctcatggcgctcccgggggtc
cgcaaggagtgcctcacccgcgtgatgagccacccgcaggcgctggcgcagtgcgagcac
acgctcaccgccatggggctcaacgtcgtccgcgaggccttcgacgacaccgcgggcgcc
gccgagtacgtcgccgccaacggcctccgcgacacggccgccatcgcctcctcccgcgcc
gccgagctgtacggcatggaggtgctcgccgacggcatccaggacgactgcggcaacgtc
acccgcttcgtcatgctcgcccgcgagcccatcgtgccccgcaccgaccgccccttcaag
accagcatcgtgttcgcccacgacaaggagggcacctccgtcctcttcaaggtcctctcc
gccttcgccttccgcgacatcaccctcaccaagatcgagagccgcccgcaccgccaccgc
cccatccgcctcgtcgacgacgccaacgtcggcaccgccaagcacttcgagtacatgttc
tacgtcgacttccaggcctccctcgccgagccccgcgcgcagaacgcgctcgccgaggtg
caggagtacacctccttcctccgggtgctcggcagctaccccatggacatgacccccatg
accgccggctcctcctccaccgtcacctccgacgattcctcctccacttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344396
Entry
4344396           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 2, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4344396
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4344396
    4.2.1.91  arogenate dehydratase
     4344396
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 4344396
NCBI-ProteinID: XP_015646555
UniProt: Q0D3B9 Q6Z3Y3
LinkDB
Position
7:complement(29579788..29583723)
AA seq 364 aa
MVSPSLRIPAAARVFDPAINTRCPPPHAVVMRMRSRSRRSIAASASPPGDPSIRDPISLP
RPLTSADLMEASGDGLKVAYQGCPGAYSEAAAKKAYPSCHTVPCEYFETAFQAVENWVAD
RAVLPLENSLGGSIHRNYDLLLRHRLHIVGEVRLAVRHCLLANRGVKIQNLRSAMSHPQA
LAQCEQTLTKLGIEHREAVDDTAGAAKLIAEQKLQDTGAVASSLAAQLYGLDILAENIQD
DTDNVTRFMMLAREPIIPRTDKPFKTSIVFSLEEGPGQLFKALAVFALRKINLTKMESRP
HKKKPLRIADDNCSAPLKHFDYLFYVDLEASMADPNAQNALANLKEFATFLRVLGSYPTD
VSEA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggtttccccttcgcttcggatccccgcggccgcgcgcgtcttcgatcccgccatcaac
acccgctgccctccgccccacgccgtcgtcatgcgcatgcgcagtcgcagccgccgttcc
atcgctgcctccgcttcgccgccgggggacccctccatccgcgaccccatctcactgcca
aggccgctcaccagcgcggatctgatggaggccagcggagacggtttgaaggtcgcatac
cagggatgcccgggtgcctacagtgaggccgccgccaagaaggcgtacccgagttgccac
accgtgccctgcgaatacttcgagaccgcctttcaggctgtcgaaaattgggtggctgac
cgcgcggtcctgccacttgagaattccttgggtggtagcatccatcgaaactatgacctt
ctacttcgccataggctgcacattgttggtgaggtgcgccttgcagttcgccattgcttg
ttagcaaatcgtggtgtgaagatccaaaatttgagaagtgccatgagccatcctcaagct
cttgcacagtgtgaacaaacactgacaaagttaggcatcgagcatagagaagctgttgac
gatacagcaggtgcagcaaagcttattgcagaacaaaagctccaggacactggagcagtt
gctagttcattggcagctcaactttatggactggatattcttgcagaaaatattcaggat
gacaccgataatgtaacacgctttatgatgctggctcgggaacccattattcctcgtact
gataagccattcaagactagcatagtcttttctttggaagaagggcctgggcaactattt
aaggcgctggcagtgtttgcactgagaaaaattaacctcaccaagatggaaagccgtcca
cacaagaaaaagcctctacgtatagctgatgataattgttctgcaccattgaagcatttc
gactacctcttctatgtagatcttgaggcgtcaatggctgatccaaatgctcaaaatgct
ctggcaaacttaaaggagttcgcaacctttctaagagttcttgggagctatcctaccgat
gtcagtgaagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347875
Entry
4347875           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4347875
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4347875
    4.2.1.91  arogenate dehydratase
     4347875
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 4347875
NCBI-ProteinID: XP_015651193
UniProt: Q0IZK1 Q650W1
LinkDB
Position
9:22542143..22546477
AA seq 401 aa
METSPALRPAHIPRSTAVRPPCATPFSRAHWHATCAAIRRVPRVNGDSNSSIKPALADHA
APPLDLDLLPVSNLPRPLTITDLSPAPMHGSQLRVAYQGVPGAYSEAAAAKAYPSCDAIP
CDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLAL
PGVRRDLLTRVISHPQALAQCELTLNAMGLNVAREAFDDTAAAAEHVAAAGLRDTAAIAS
SRAAELYGLQVLADGIQDDAGNVTRFVMLAREPIIPRTDRPFKTSIVFAHDREGTSVLFK
VLSAFAFRDISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYIDFQASMAEVRAQNAL
SEIQEFTSFLRVLGSYPMDMTPWEYSSSSSPSPAPGGDTSR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaaacctcgcccgcgctgcgccccgcccacatccccagatccacggccgtccgcccg
ccgtgcgccacccctttctcccgcgcccactggcacgccacctgcgccgccatccgccga
gtcccgcgggtgaacggcgacagcaacagtagcatcaagcccgccctcgccgaccacgcc
gcgccgccgctcgacctggatctgctccccgtctccaacctccctcgcccgctcaccatc
accgacctctcccccgcgcccatgcacggcagccagctgcgcgtcgcctaccagggtgtc
ccgggggcatacagcgaggcggcggcggcgaaggcctacccctcctgcgacgccatcccc
tgcgaccagttcgaggtggccttccaggccgtcgagctctggatcgccgaccgcgccgtc
ctccccgtcgagaactccctcggcggcagcatccaccgcaactacgacctcctcctccgc
caccgcctccacatcgtcggcgaggtccagctccccgtccaccactgcctcctcgcgctc
ccgggcgtccgcagggacctcctcacccgcgtcatctcccacccgcaggcgctcgcccag
tgcgagctcaccctcaacgccatgggcctcaacgtcgcccgcgaggccttcgacgacacc
gcggccgccgccgagcacgtcgccgccgcggggctccgcgacaccgccgccatcgcgtcc
tcccgcgccgccgagctgtacgggctccaggtgctcgcggacggcatccaggacgacgcc
gggaacgtgacgcggttcgtgatgctggcgcgggagcccatcatcccgcgaacggaccgg
ccattcaagacgagcatcgtgttcgcgcacgacagggagggcacgtcggtgctcttcaag
gtgctgtcggccttcgcgttccgggacatcagcctcaccaagatcgagagccgcccacac
cgccaccgccccatccggctcgtcgacgacgccaacgtgggcacggccaagcacttcgag
tacatgttctacatcgacttccaggcgtccatggcggaggtcagggcgcagaacgcgctg
tcggagatacaggagttcacctccttcctccgggtgctcggcagctaccccatggacatg
acgccatgggagtattcctcctcatcgtcaccatcaccggcgcccggcggcgacaccagc
agataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347877
Entry
4347877           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4347877
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4347877
    4.2.1.91  arogenate dehydratase
     4347877
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 4347877
NCBI-ProteinID: XP_015611606
UniProt: Q652N0 Q650V6
LinkDB
Position
9:22563885..22565638
AA seq 407 aa
MMETLPAPRPTQIPRSTAIRPPCATPFSRAHWQTTCAAILATTTTTNAKAYGAPRVNGDS
IKPALSDHAAPPLDLDLLPVSNLPRPLTITDLSPAPMHGSQLRVAYQGVPGAYSEAAAAK
AYPSCDAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQL
PVHHCLLALPGVRRDLLTRVISHPQALAQCELTLNAMGLNVAREAFDDTAAAAEHVAAAG
LRDTAAIASSRAAELYGLQVLADGIQDDAGNVTRFVMLAREPIIPRTDRPFKTSIVFAHD
REGTSVLFKVLSAFAFRDISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYIDFQASM
AEVRAQNALSEIQEFTSFLRVLGSYPMDMTPWEYSSSGQTAGDTSSS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgatggaaactctgcccgcgccgcgccccacccagatccccagatccacggccatccgc
ccgccgtgcgccacccccttctcccgcgcccactggcagaccacctgcgccgccatcctc
gccaccaccactaccaccaacgccaaagcctatggcgccccgcgggtgaacggcgacagc
atcaagcccgccctctccgaccacgccgcgccgccgctcgacctggatctgctccccgtc
tccaacctccctcgcccgctcaccatcaccgacctctcccccgcgcccatgcacggcagc
cagctgcgcgtcgcttaccagggtgtcccgggggcatacagcgaggccgccgccgccaag
gcctacccctcctgcgacgccatcccctgcgaccagttcgaggtggccttccaggccgtc
gagctctggatcgccgaccgcgccgtcctccccgtcgagaactccctcggcggcagcatc
caccggaactacgacctcctcctccgccaccgcctccacatcgtcggcgaggtccagctc
cccgtccaccactgcctcctcgcgctcccgggcgtccgcagggacctcctcacccgcgtc
atctcccacccgcaggcgctcgcccagtgcgagctcaccctcaacgccatgggcctcaac
gtcgcccgcgaggccttcgacgacaccgcggccgccgccgagcacgtcgccgccgcgggg
ctccgcgacaccgccgccatcgcgtcctcccgcgccgccgagctgtacgggctccaggtg
ctcgcggacggcatccaggacgacgccgggaacgtgacgcggttcgtgatgctggcgcgg
gagcccatcatcccgcgaacggaccggccattcaagacgagcatcgtgttcgcgcacgac
agggagggcacgtcggtgctcttcaaggtgctgtcggccttcgcgttccgggacatcagc
ctcaccaagatcgagagccgcccacaccgccaccgccccatccggctcgtcgacgacgcc
aacgtgggcacggccaagcacttcgagtacatgttctacatcgacttccaggcgtccatg
gcggaggtcagggcgcagaacgcgctgtcggagatacaggagttcacctccttcctccgg
gtgctcggcagctaccccatggacatgacgccctgggagtattcctcctccggccaaacc
gccggcgacaccagcagcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349157
Entry
4349157           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4349157
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     4349157
    4.2.1.91  arogenate dehydratase
     4349157
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-GeneID: 4349157
NCBI-ProteinID: XP_015614828
UniProt: A0A0P0XWD4 Q8H0A1
LinkDB
Position
10:complement(20345116..20347064)
AA seq 408 aa
MAYTSSSLHLHKHLLLPKTNPSSSYSRPPPPSFVAAAAKINGVNGHSSKKSPNGKAQING
DGKKGVNGSGRKKAAAQHINGNDRIHLSVSTGGAGGQDGFGLRVAFQGAPGAYSEFAAKT
ALPGCDTVPCRAFADALAAVDGGAVDRAILPVESTMEGTALRNYDLLLRHDLVVVQEINL
FVHYCLLAMPGVRAAEVRRVISHPMALAHCGRALARLGVDREPVEDTAGAVEMLRSNRML
DTAAIASPRAADLYGLDVLAHGLQDESWNVTRFLLLSKPPSPVTLPMDADAKTSMVVAHR
GGSMMVVLKVLSAFSSRNINLTKLEVINNNDGGGGGGGAAAGHPVMILDTSARGAPTLRA
FPHVLYVDCEGASHDPRVLDAIKEIERFAVFVRVLGCYAADSNVYDLQ
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcctacacctcctcctccctccacctccacaagcacctcctcctccccaagaccaac
ccctcctcctcctactcgcggcctccgcctccgtcgttcgtcgccgcggcggccaagatc
aacggcgtcaacggacactcctccaagaagtcccccaacggcaaggcgcagatcaacggc
gacggcaagaagggggtcaacgggagcgggaggaagaaggcggcggcgcagcacatcaac
gggaatgaccggatccatctgtcggtgagcacgggcggcgccgggggccaggatgggttc
gggctcagggtggcgttccagggcgcgccgggcgcgtacagcgagttcgcggcgaagacg
gcgctccccgggtgcgacaccgtgccctgccgcgcgttcgccgacgcgctggcggcggtc
gacggcggcgccgtcgaccgcgcgatactgcccgtcgagtccaccatggagggcaccgcg
ctgcggaactacgacctcctgctgaggcatgacctcgtcgtggtccaggagatcaacctg
ttcgtgcactactgcctcctcgccatgcccggtgtccgcgccgccgaggtgcgccgggtg
attagccaccccatggcgctcgcgcactgcggccgtgcgctggcgcggctcggcgtggac
agggagcccgtggaggacaccgccggcgccgtggagatgctgcggtccaaccggatgctc
gacaccgccgccatcgccagcccgcgcgccgccgacctctacggcctcgacgtgctcgcg
cacggcctccaggacgagtcatggaacgtcacccgcttcctgctcctctccaagccgccc
tcgccggtgacgctgcccatggacgccgacgccaagaccagcatggtggtcgcccaccgg
ggcggctccatgatggtggtcctcaaggtcctctccgccttctcctcccgcaacatcaac
ctgaccaagctggaggtcatcaacaacaacgacggcggcggcggcggcggtggcgccgcg
gcgggccaccccgtgatgatcctcgacacgagcgcccgcggcgcgccgacgctccgcgcg
ttcccgcacgtcctctacgtcgactgcgagggcgcctctcacgacccgcgcgtcctcgac
gccatcaaggagatcgagagattcgcggtgttcgtccgcgttcttggctgctacgccgcc
gattccaacgtctacgacctgcaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268104
Entry
9268104           CDS       T01015                                 
Name
(RefSeq) arogenate dehydratase/prephenate dehydratase 2, chloroplastic isoform X1
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    9268104
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     9268104
    4.2.1.91  arogenate dehydratase
     9268104
SSDB
Motif
Pfam: PDT ACT
Other DBs
NCBI-GeneID: 9268104
NCBI-ProteinID: XP_015646890
LinkDB
Position
7:complement(19595291..19609240)
AA seq 403 aa
MATAASCLSVFAGAAATTVAASSRLMSRRAVACAGYAGMDDGGGGEGMMIMARRRRLVVP
GIIATAGGGVRLRPATKGAYTCARAQRARGPSLATDQSLDIERANVHVAYQGSPGTAIEE
MVFKAFPDCIAVPCKKFVAAFEVAVDSSLADIVVLPIENSSTGSFHQNYDLLLRHKLHIV
QEVQVEIELCLWALPGVQKNDLRTIFSHPEEFAQCEHSLSSLRVIKKNVDHCAAGAEIIS
MQNLGDAGVIGNAQAAELYGLNIVECNFQDASPNLTRYLVLAKTADIPKEYGQYKTSIVF
GLEEGPGILFKALSAFWMRDINLSKIESRPNKREPMRTQGNEKHFNYIFYVDFEASTAEV
RVQNALNDLKVQQRATFLRVLGCYQMREVGLTAPICQLSVSST
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctaccgccgcctcgtgcctctcggtgttcgctggcgccgccgcgacgacggtggcc
gcaagcagccggctgatgtcgcggcgggcggtcgcctgtgctggctacgcggggatggat
gatggtggtggcggcgaggggatgatgatcatggcgcgacgacgccgcctggttgtgccg
gggatcatcgctacggccggcggcggcgtgaggcttcgaccggctaccaagggtgcgtat
acatgcgcacgtgcacagcgtgcaagaggaccatcacttgccactgatcagtcattagat
attgaaagggctaatgtccatgtggcgtatcagggctcacctggtacggccattgaggag
atggtgtttaaggccttcccagactgtatagccgttccctgcaaaaagtttgtggctgca
tttgaggttgcggttgactcttcacttgctgacatagttgttcttcctattgaaaattca
tccactggaagctttcaccagaactatgacttacttcttcgacataagttgcatattgtg
caagaagttcaagtggagatagagctgtgtctctgggctcttccaggagtgcagaagaat
gatttgagaacgattttcagccatccagaggaatttgctcagtgcgagcattcactctct
agtcttagggttataaagaaaaatgtcgaccactgtgctgctggtgccgagattatatcc
atgcaaaatttaggagatgctggagttataggcaatgctcaagcggcggaattgtatggg
cttaacatagtagaatgcaactttcaggatgcttcacccaatctcacaagatacttggta
ttggccaaaactgctgacatccccaaggaatatggccaatataagacaagcatcgttttc
ggtcttgaagaagggcctggcatacttttcaaggccttgagtgcattttggatgagggat
ataaatttgtcaaagattgagagcagaccaaataagcgcgaaccaatgaggactcaagga
aatgaaaagcacttcaattacattttctatgttgattttgaagcatcaacagccgaagta
cgtgtgcaaaatgctttgaatgatctgaaggtgcagcaaagggctactttcctgcgtgtc
cttggctgctatcaaatgagagaagtaggattgactgcaccaatttgtcaactctcggtt
tcttcaacctga

DBGET integrated database retrieval system