KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332497
Entry
4332497           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phospholipase C 4 isoform X1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4332497
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4332497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332497
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4332497
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4332497
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4332497
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Other DBs
NCBI-GeneID: 4332497
NCBI-ProteinID: XP_015628696
LinkDB
Position
3:10023964..10028121
AA seq 598 aa
MGTYKCCIFFTRRFALSDASTPGDVRMLFTRHAGGAPYMGIDELRRYLAASGEAHVDADT
AERIIDRVLQERSRTPRFGKPSLTIDDFQYFLFSEDLNPPICHSKEISCSQVHHDMNAPL
SHYFIYTGHNSYLTGNQLSSDCSDIPIIKALQIGVRVIELDMWPNSSKDDVDILHGRTLT
APVSLIKCLKSIKEYAFVASPYPVIITLEDHLTSDLQAKVAKMVLEVFGDTLYYPESKHL
QEFPSPEALRGRVILSTKPPKEYLESKGGTMKDRDIEPQFSKGQNEEAVWGTEVPDIQDE
MQTADKHENDILYTQRDVEEDDEKKMCQHHPLEYKHLITIKAGKPKGAVVDALKGDPDKV
RRLSLSEQELAKVAAHHGRNIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFN
MQGYGRSLWLMHGFYKANGGCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGE
GWQSDFKQTYFDTYSPPDFYAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPE
IALLRVEVHEYDVSEDDFGGQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggggacgtacaagtgctgcatcttcttcacccgcaggttcgcgctgagcgacgcgtcc
acgccgggcgacgtgcgcatgctgttcacccgccacgccggcggcgcgccctacatgggc
atcgacgagctccggcgctacctcgccgccagcggggaggcccacgtcgacgccgacacg
gcggagcggatcatcgaccgggtcctgcaggagcgcagccgcaccccgcgcttcgggaag
ccgtcgctcaccatcgacgatttccagtacttcctcttctccgaggacctcaacccgccc
atctgccattccaaggaaatctcgtgctctcaggtccatcacgacatgaatgcaccatta
tcgcactacttcatatacactggacacaactcgtatctgacgggcaatcaacttagcagt
gactgcagtgatattcccatcattaaggcactgcaaataggcgtccgtgtaattgaactg
gacatgtggccaaattcttctaaagatgatgttgatattctccatggaaggacactgact
gccccagtatcacttatcaaatgcttgaaatccatcaaagaatatgcctttgttgcgtct
ccctaccctgttattataacattagaagaccaccttacatctgatcttcaggcgaaagta
gctaagatggttcttgaagtatttggagataccctatattatcccgagtcaaaacatctt
caagaatttccttcacccgaagcactgaggggacgtgtcatcctctcaacaaaaccccca
aaggagtaccttgaatcaaaaggtggtactatgaaagacagagacattgagcctcagttt
agcaaaggacaaaatgaagaagctgtctggggaacagaagtcccagatattcaggatgag
atgcaaaccgccgacaagcatgagaatgatatactatacacccaaagagatgtggaagaa
gatgatgagaagaaaatgtgccagcatcacccactagagtataaacaccttattactatt
aaggcaggaaagccaaagggtgctgtagttgatgccttaaagggtgatccagataaagtt
agacgcctcagtttgagtgagcaggaacttgcaaaagtggcagcgcatcatggtcgtaac
atcgtgagctttacacataaaaatcttctgagaatatacccaaagggcactcgcttcaat
tcttcgaactataatccgtttcttggttgggtgcatggtgcacaaatggtggcatttaat
atgcaggggtatggaagatctctttggctaatgcacggattctacaaggccaacggtggc
tgcggttatgtgaagaagccagatttcatgatgcaaacttgtccagatggaaatgttttt
gacccgaaagcagatttacctgtgaagaaaacactcaaggtcaaagtatacatgggcgaa
ggttggcagagcgacttcaagcagacatacttcgacacgtattcccctccagacttctac
gcaaaggtgggcattgccggggttccgtcggactcggtgatgcagaagacgaaagccgtg
gaggacagctgggttcccgtgtgggaggaggagttcgtgttcccgctgaccgtcccggag
atcgcgctgctccgcgtggaggtgcacgagtacgacgtgagcgaggacgacttcggcggg
cagacggcgctcccggtgtcggagctgcggccggggatccgcaccgtgccgctcttcgac
cacaaggggctcaagttcaagagcgtcaagctcctcatgcggttcgagttcgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337686
Entry
4337686           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phospholipase C 2
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4337686
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4337686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337686
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4337686
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4337686
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4337686
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Other DBs
NCBI-GeneID: 4337686
NCBI-ProteinID: XP_015640813
UniProt: A0A0P0WHG1
LinkDB
Position
5:1535614..1541565
AA seq 598 aa
MTTYRVCCFLRRFRAASNEPSEELGDVFQAYADGGGGVMGEEALRRFLREVQGEAAGGGD
DELEATAREVMAFAAEQRLLRKGGAAAAGGGLTVEGFHRWLCSDANAALDPQKRVYQDMG
LPLSHYFIYTGHNSYLTGNQLSSGCSEVPIVKALHDGVRVIELDLWPNAAKDAVEVLHGR
TLTSPVGLMKCLEAIREYAFVASPYPVILTLEDHLTPDLQSKVAKMIKETFGDMLYVSET
ENMAEFPSPDELKGKIIVSTKPPKEYLQTKNDADADEAGVWGEEITDDKVAATAMTTEEK
CAAAEEAVAAAAVDEEMQEAETDKKTQHGVDNEYRRLIAIPLTRRKHDMDQDLKVDPDMV
TRLSLGEKAYEKAIVTHGAHIIRFTQRKLLRIFPRSTRITSSNYNPLMGWRYGVQMVAAN
MQGHGRKLWLTQGMFRANGGCGYVKKPDILMNNDPDKLFDPTSKLPVKTRLKVTVYMGDG
WRFDFRKTHFDKCSPPDFYARVGIAGVEADTRMEQTKVKMDTWIPAWDHEFEFPLSVPEL
ALLRVEVHESDNHQKDDFGGQTCLPVWELRRGIRSVRLCDHRGEPLRSVKLLMRFDFT
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgacgacgtacagggtgtgctgcttcctgcggcggttcagggcggcgtcgaacgagccg
tcggaggagctcggcgacgtgttccaggcgtacgccgacggcggcggcggcgtgatgggg
gaggaggcgctgaggcggttcctccgggaggtgcagggggaggccgccggcggcggcgac
gacgagctggaggcgacggcgagggaggtgatggccttcgcggcggagcagaggctgctc
aggaagggcggcgccgctgccgccggcggcgggctcaccgtcgagggcttccaccgctgg
ctgtgcagcgacgccaacgctgcactggatcctcagaaacgggtatatcaagacatggga
ttgcctctgtcacactacttcatctacacggggcacaactcatacctgacggggaaccag
ctgagcagcgggtgcagcgaggtgcccatcgtgaaggccctccacgacggcgtccgtgtc
atcgagctcgacctctggcccaacgctgccaaggacgccgtcgaggtcctccacggcagg
acgctgacatcgccagtgggtctgatgaaatgccttgaggccatcagggagtacgcgttc
gtcgcctccccttaccccgtcatcctcaccctcgaagatcacctcactcccgacctccaa
tccaaagtcgccaagatgatcaaggagacgttcggtgacatgctctacgtctctgaaact
gagaacatggcggaattcccttcgccggacgagctcaaggggaagatcatcgtgtcgacg
aagccgcccaaggagtacctccagaccaagaacgacgccgacgccgacgaggccggcgtc
tggggcgaggagatcaccgacgacaaggtggcggcgacggcgatgacgacagaagagaaa
tgcgcggcggcggaggaagcagtcgccgccgccgccgtcgacgaggagatgcaggaggcc
gagacggacaagaagacgcagcacggggtggacaacgagtacaggcgcctcatcgccatc
cctctgacaagaagaaagcacgacatggatcaggacctcaaggtcgatcccgacatggtg
acgcgcctcagcctcggggagaaggcctacgagaaggccattgtcacccatggagctcac
attatcaggtttacgcagaggaaattgctgaggatattccctcggtcgacgcgcattacg
tcttcgaattataatcctttgatgggttggaggtatggagttcagatggttgcagcaaac
atgcagggccatggaagaaagctgtggctgactcaggggatgttccgagcaaacggcggt
tgcggttacgtcaaaaagcctgatattctgatgaacaacgatccagataaactgtttgat
cctacatccaaactaccagtaaagacaagactaaaggtgacggtgtacatgggagacgga
tggcgattcgacttccgcaagacacatttcgacaaatgctcacccccagacttctatgca
agggtgggtatagccggagtagaagcagacacgaggatggagcagacgaaggtgaagatg
gacacgtggattccggcatgggatcacgagttcgagttcccgttgagcgtgccggagctg
gcgctgctccgggtggaggtgcacgagtccgacaaccaccagaaggacgacttcggcggg
cagacctgcctgccggtgtgggagctccggcgaggcatccgctccgtcaggctctgcgac
caccgcggcgagcccctccgctccgtcaagctcctcatgcgcttcgacttcacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344391
Entry
4344391           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phospholipase C 2
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4344391
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4344391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344391
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4344391
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4344391
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4344391
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y C2
Other DBs
NCBI-GeneID: 4344391
NCBI-ProteinID: XP_015646464
UniProt: Q6Z3Y9 A3BNQ7
LinkDB
Position
7:complement(29545840..29548978)
AA seq 598 aa
MGTYKCCLIFKRRFRWNDAPPPDDVRALFANHSAGGGPHMAADGLRAYLQATGQDGDVDM
ERLVEQIRQLQGRGGRIPRVGRALPLLTVDDFHRFLFSHELNPPIRHGQGQVHHDMAAPL
SHYFIYTGHNSYLTGNQLSSDCSDLPIIRALQRGVRVIELDMWPNSSKDDISILHGRTLT
TPVSLLKCLLSIKQHAFEASPYPVIITLEDHLTPDLQDKAAKMVLEVFGDILYYPDKDHL
KEFPSPQDLKGRVLLSTKPPREYLQAKDGNAATIKEDAKAAATDDAAWGKEVPDIHSQIH
SATKHDQREDDDDTDEDEDDEEEEQKMQQHLAPQYKHLITIKAGKPKGTLLDALQSDPEK
VRRLSLSEQQLAKLADHHGTEIVRFTQRNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAF
NMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSPKKTLKVKVYMGDG
WRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEEDFTFKLTVPEI
ALLRVEVHEYDMSEKDDFGGQTVLPVSDLIPGIRAVALHDRKGIKLNNVKLLMRFEFE
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgggcacgtacaagtgctgcctcatcttcaagcgccgcttccgctggaacgacgcgccg
ccgcccgacgatgtccgcgccctcttcgccaaccactccgccggcggtggcccccacatg
gccgccgacggcctccgcgcctacctccaggccaccggccaggacggcgacgtggacatg
gagcggctggtggagcagatccggcagctgcaggggcgcggcgggcgcatcccgcgggtg
gggcgggcactcccactcctgacggtggacgacttccaccgattcctcttctcccacgag
ctgaacccacccatccggcacgggcaggggcaggtgcaccacgacatggccgccccgctc
tcccactacttcatctacaccggccacaactcctacctcaccggcaaccagctcagcagc
gactgcagcgacctccccatcatcagggctctccagaggggcgtccgcgtcatcgagctc
gacatgtggcccaactcctccaaggatgacatcagcatcctccatggcaggacgctcacc
accccggtctccctcctcaaatgcctcctctccatcaagcaacacgcctttgaggcctcc
ccttacccggttatcatcacgctcgaagaccacctcacccccgatctccaggacaaagca
gccaagatggttcttgaagttttcggcgacatcctctactaccctgacaaagatcacctc
aaagagttcccttcgcctcaagacctcaagggccgtgtcctcctctccaccaagcccccc
agggagtaccttcaagccaaggatggtaatgctgccaccatcaaagaggacgccaaggcc
gccgccactgacgatgccgcatggggaaaagaagtcccagatattcactctcaaatccac
tctgccactaaacatgaccaaagagaagatgacgacgacaccgatgaagacgaagatgac
gaggaggaggagcagaaaatgcaacagcatctagctccacagtacaaacaccttattacc
atcaaagcaggaaagccaaaaggtactctacttgatgccttacagagtgacccagaaaag
gttagaaggctcagtttgagcgagcaacaacttgccaaattggcagatcatcatggtacc
gaaattgtaaggttcacacagagaaacctactgaggatatacccaaagggcactcgggtc
acatcatccaactataatccatttcttggttgggtgcatggtgctcagatggtagcgttc
aatatgcagggatatggaagagctctttggttgatgcatggattttataaagctaatggt
ggctgtggttatgtgaagaaaccagatttcttaatgcaaactgatccagaggtttttgac
ccaaaaaaatccctatctcccaagaaaaccttgaaggtgaaagtatacatgggggatggt
tggcggatggacttcacgcagacccactttgatcaatattctcctccagacttttatgca
cgggtggggatagcgggagtaccagcggactcggtgatgaagagaacgagggcgatagag
gataactgggtgccggtgtgggaggaggatttcaccttcaaactgaccgtgccggagatc
gcgttgctgcgggtggaggtgcacgagtacgacatgtcggagaaggacgacttcggcggc
cagacggtgctgccggtgtcggatctcatcccggggatccgagcggtggcactccacgac
cgcaaagggatcaagttgaacaacgtcaagcttctcatgcgcttcgagtttgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352524
Entry
4352524           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phospholipase C 6
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4352524
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4352524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352524
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4352524
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4352524
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4352524
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 SMI1_KNR4
Other DBs
NCBI-GeneID: 4352524
NCBI-ProteinID: XP_015618103
UniProt: Q2QNK1 A0A8J8XWU8
LinkDB
Position
12:23048705..23053341
AA seq 590 aa
MGSYAYKYCMCFTRKFRSPAADPPPDVRAAFLAAGGGDGGLRRFLAQAQGETPAEVDRIL
ALLSGGGGGGGGGGIAARLVGPRPGPAPSLDDFFGFLFNADLNPPIATQVHQDMSAPFSH
YYIYTGHNSYLTGNQLNSDSSDIPIIKALQRGVRVIELDMWPNSAKNNIDILHGGTLTAP
VQIIKCLKSIKEYAFCASPYPLVITLEDHLTPDLQAKVAEMLVKTFGNLLYIPSSDPINE
FPSPESLMKKIIISTKPPEEYKKFLKSKDNQNINGGLANLAEEGSLRRIDSNAEESDGKD
ELDDQDEDSSDEDDPKFQQETACEYRELITIHAGKPKGHLKDALKVDPDKVRRLSLSETQ
LAKATASHGADVIRFTQKNILRVYPKGTRINSSNYDPMNAWTHGAQMVAFNMQGHDKALR
LMQGFFRANGGCGYVKKPDFLLRTGPNGEVFDPNASMPVKKTLKVKVYMGDGWRMDFSKT
HFDTFSPPDFYTRVGIAGVRADCVMKKTRTIEDQWVPMWDEEFTFPLTVPELAVLRIEVH
EYDMSEKHDFGGQTCLPVSELKQGIRAVPLHDRRGTRYKSVRLLMRFDFL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggggagctacgcgtacaagtactgcatgtgcttcacccgcaagttccgctcgccggcg
gccgacccgccgccggacgtccgcgccgccttcctcgccgccggcggaggcgacggcggg
ctccggcggttcctcgcgcaggcgcagggggagacgccggcggaggtggaccgcatcctc
gcgctgctcagcggcggtggcggcggcggcggaggaggaggcatcgcggcccgcctcgtg
ggcccccggcccggcccggccccctcgctcgacgacttctttgggttcctcttcaacgcc
gatctcaacccacccatcgccacccaggttcaccaggacatgtcggcgccgttttcgcac
tattacatatacaccgggcacaattcctacttgactgggaaccagctgaacagtgattcc
agcgacattccgattatcaaagcattgcagaggggtgtcagggtgattgagctcgatatg
tggccgaattccgctaagaacaacattgacattcttcatggagggacattgactgcacct
gtacaaatcatcaaatgtttgaagtccattaaagaatacgccttttgtgcttcaccatat
cctcttgtcattactcttgaggatcacctcacaccggacctccaagctaaagtagctgag
atgctcgtcaaaacatttggaaatctcctttacattcctagttcagacccaataaatgag
tttccttctccagaatctctaatgaagaaaataatcatctcaactaaaccaccagaagaa
tacaagaagtttcttaaatctaaggataatcagaacatcaatggcggcttagctaatctg
gcagaggaaggaagcttgagaagaatagattcaaatgctgaagaatcggatggaaaggat
gaactggatgatcaagatgaggactcctctgatgaggatgatcccaaatttcagcaggaa
acagcctgtgagtatagggaactgatcaccatccacgctggcaaaccaaaaggccatttg
aaggatgcgcttaaggtggatcctgacaaagtcaggcgcctttctttgagcgaaacacag
ctagctaaagcaacagcttctcatggtgccgatgttataaggttcacccagaagaatata
ctcagggtgtatccgaagggtacaaggattaattcttccaactatgatccaatgaatgcc
tggactcatggtgctcagatggttgcatttaacatgcaggggcatgacaaagcactccgg
ttaatgcaaggattttttagagctaatggaggttgtggctatgtcaaaaagcctgacttc
ttgcttaggacaggtccaaatggtgaagtatttgaccctaacgcaagtatgcctgtgaag
aaaactctgaaggtgaaagtatatatgggagatggatggcgaatggatttcagtaaaact
catttcgacaccttctctcctcctgatttctatactagggtggggatcgctggtgtgcgg
gcagattgtgtgatgaagaagactcgaacaatcgaggatcagtgggtaccgatgtgggat
gaggagttcacattccctctgacagtcccggagctggctgtgctgagaatcgaggttcat
gagtacgacatgtcggagaagcatgactttggggggcagacatgcctgccagtgtcggag
ctgaagcagggcatccgcgctgtgcctctccacgatcgccggggcaccaggtacaagtct
gtcaggctcctcatgcgcttcgacttcctctag

DBGET integrated database retrieval system