KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332506
Entry
4332506           CDS       T01015                                 
Name
(RefSeq) asparagine synthetase [glutamine-hydrolyzing] 1
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4332506
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     4332506
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4332506
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Other DBs
NCBI-GeneID: 4332506
NCBI-ProteinID: XP_015632089
UniProt: Q10MX3
LinkDB
Position
3:complement(10120288..10124378)
AA seq 604 aa
MCGILAVLGAADWSQAKRAHVLSCSRRLKHRGPDWSGLYQCEGNFLAQQRLAIVSPLSGD
QPLYNADRTIVVVANGEIYNHKKIRKQFASKHTFSTGSDCEVIIPLYEEYGEDFVDMLDG
VFAFVLYDTRTKTYMAARDAIGVNPLYIGRGSDGAVWISSEMKALNEDCVEFEIFPPGHL
YSSAAGGLRRWYKPQWFAENVPATPYQPLLLREAFEKAVIKRLMTDVPFGVLLSGGLDSS
LVAAVTKRHLIKTEAAEKFGAELHSFVVGLEGSPDLIAAREVADHLGTIHHEFHFTVQDG
IDAIEEVIYHDETYDVTTIRASTPMFLMARKIKALGVKMVLSGEGSDELLGGYLYFHFAP
NKEEFHKETCRKVKALHQYDCLRANKATSAWGLEVRVPFLDKEFINVAMSMDPEWKMYNA
DLGRIEKWVMRKAFDDEEHPYLPKHILYRQKEQFSDGVGYNWIDGLKAFTEQQVSDEMMK
NAAKVYPHNTPVNKEAYYYRMIFERLFPQESARETVPWGPSIACSTPAAIEWVEQWKASH
DPSGRLIASHNSASASANHTNHANANANGNSNGKANGNCAMAANGTNGVGLVVANGTANG
KMEA
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtgcgggatcctggccgtgctcggcgccgccgactggtcgcaggcgaagagggctcac
gtcctctcctgctcccgcaggctgaagcacaggggacccgactggtccgggttgtaccag
tgcgagggaaacttcctcgctcagcagcgtctcgccatcgtctccccgctctccggcgac
cagccgctgtacaacgcggaccggaccatcgtcgtcgtggccaatggagagatctacaac
cacaagaagatcaggaagcagttcgcctccaagcacacgttcagcaccggcagcgactgc
gaggtcatcatcccgctgtatgaggagtacggcgaggacttcgtcgacatgctggacggc
gtgttcgccttcgtcctctacgacacccgcaccaagacgtacatggccgcccgcgacgcc
atcggcgtcaaccccctctacatcggcaggggcagcgacggcgccgtctggatatcgtcc
gagatgaaggcgctgaacgaggactgcgtggagttcgagatcttccctccgggccacctc
tactccagcgccgccggcgggctccggcggtggtacaagccgcagtggttcgccgagaac
gtcccggcgacgccgtaccagccactcctcctcagagaggccttcgagaaggccgtcatc
aagaggctcatgaccgacgtgcccttcggcgtcctcctctccggcggcctcgactcctcc
ctcgtcgccgcggtgaccaagcgccacctcatcaagactgaagccgccgagaagttcgga
gctgagctccattccttcgtcgttggccttgagggttcccctgacctgatagctgcacga
gaggtcgctgaccacctaggaaccatccatcacgagttccacttcactgtccaggatggc
atcgacgcgatcgaggaggtcatctaccacgacgagacgtacgacgtgacgacgatacgg
gccagcacgccgatgttcctgatggcgcgcaagatcaaggcgctcggggttaagatggtg
ctgtccggtgaaggctccgacgagctcctcggcggttacctctacttccacttcgccccc
aacaaggaagagttccacaaggagacctgccgcaaggtgaaagcacttcatcagtatgac
tgtctgcgtgctaacaaggcgacgtctgcctggggactggaggtccgtgtgccgttcctc
gacaaggagttcatcaacgtcgccatgagcatggaccctgagtggaagatgtacaatgct
gatcttggtcgcatcgagaagtgggttatgaggaaggcgttcgacgacgaggagcatcct
tacctgccgaagcacatactgtacaggcagaaagagcagttcagtgatggcgtcggctac
aactggatcgatggcctgaaggctttcaccgagcagcaggtcagtgatgaaatgatgaag
aacgctgccaaagtgtacccgcacaacacgcccgtcaacaaggaggcgtactactaccgc
atgatatttgagaggctcttcccgcaggaatcggcgagggagacggtgccgtggggcccg
agcatcgcgtgcagcacgccggcggcgatcgagtgggtggagcagtggaaggcgtcgcac
gacccatccggccggctgatcgcctcccacaactccgcctccgcctccgccaaccacacc
aaccacgcaaacgccaacgccaacggcaacagcaacggcaaggccaacggcaactgcgcg
atggcggccaacgggacgaacggcgtcggcctggttgtggccaacgggacagccaacggg
aagatggaagcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333381
Entry
4333381           CDS       T01015                                 
Name
(RefSeq) isoaspartyl peptidase/L-asparaginase 1
  KO
K13051  L-asparaginase / beta-aspartyl-peptidase [EC:3.5.1.1 3.4.19.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00460  Cyanoamino acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4333381
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4333381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4333381
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     4333381
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     4333381
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T2
   4333381
SSDB
Motif
Pfam: Asparaginase_2 CP_ATPgrasp_1 Dicistro_VP4
Other DBs
NCBI-GeneID: 4333381
NCBI-ProteinID: XP_015628657
UniProt: Q10H87 Q0DQG7
LinkDB
Position
3:complement(22255194..22259475)
AA seq 317 aa
MGWAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELEN
CPHYNAGVGSVLTADGTVEMEAAVMDGNTLRCGAVSGLSTVVNAVSLARLVMEKTPHIYL
AFDGAEAFAREQGVETKDPSHFITEANKERLRQAKEANRVQVDYTQPIPKDDNSRVGTVG
CVAIDSAGNLATATSTGGLVNKMAGRIGDTPVIGAGTYANALCAVSATGVGEAIIRHTVA
RDVAALLEHAPPAGLSLGDAAARVVAGVPPGKVGLVAVSAAGEVAMAYNTTGMFRACATE
GGRHEVAIWPDDADGAN
NT seq 954 nt   +upstreamnt  +downstreamnt
atggggtgggcggtcgcgctgcacggcggcgccggggacatcccgcgctcgctgccgccc
gaccgcagggagccccgcctcgccacgctccgccgctgcctcgacctcgccaccgccgcg
ctccgttccggccgcgctgccctcgacgtcgtcgagctcgtcgtgagggagctggagaac
tgcccgcactacaacgccggcgtgggctccgtgctcaccgccgacggcaccgtcgagatg
gaggccgccgtcatggacggcaacaccttgcgctgcggcgccgtctccggactctccacc
gtcgtcaacgccgtctccctcgccaggctcgtcatggagaagacgccgcacatctacctc
gccttcgatggcgccgaggccttcgccagggagcagggagtggagactaaagatccaagc
cactttattacggaggcaaacaaagagaggctcagacaagcaaaagaagccaacagggtg
caggtggattacacccaaccaattcccaaggacgacaacagccgggtcggcacggtgggc
tgcgtggccatcgactccgccggcaacctcgcgacggcgacgtccaccggcgggctggtg
aacaagatggccggcaggatcggcgacacgccggtgatcggcgccgggacgtacgccaac
gcgctgtgcgccgtgtcggccacgggcgtgggcgaggccatcatccggcacacggtggcg
cgcgacgtcgcggccctgctggagcacgccccgccggccggcctctccctgggggacgcc
gccgcgcgcgtcgtggccggcgtgccgccgggcaaggtcgggctggtggccgtgtcggcc
gccggcgaggtggccatggcgtacaacaccaccggcatgttcagggcgtgcgccacggag
ggcggccgccacgaggtggccatctggcctgacgacgctgatggtgctaattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337229
Entry
4337229           CDS       T01015                                 
Name
(RefSeq) probable isoaspartyl peptidase/L-asparaginase 2
  KO
K13051  L-asparaginase / beta-aspartyl-peptidase [EC:3.5.1.1 3.4.19.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00460  Cyanoamino acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4337229
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4337229
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4337229
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     4337229
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     4337229
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T2
   4337229
SSDB
Motif
Pfam: Asparaginase_2
Other DBs
NCBI-GeneID: 4337229
NCBI-ProteinID: XP_015635450
UniProt: A0A0N7KJU1 Q7XMP7
LinkDB
Position
4:33161528..33164524
AA seq 333 aa
MARWAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELES
DPFFNSGRGSALTRLGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARLVMDKSPHSYL
AFDGAEQFARDQGLEVVDNSYFITEDNVGMLKLAKEANSILFDYRIPLSGSETCGAQAVS
SDNSHGNGMVMNGLPISIYAPETVGCAVVDSSGHTAAATSTGGLMNKMTGRIGDSPLIGS
GTYACGACAVSCTGEGEAIIRSTLARDVAAVMEYRGAGLQEAVDYCVKKRLDEGFAGLIA
VSSTGEVAYGFNCTGMFRGCATEDGFMEVGIWE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcgaggtgggccattgcgatccacggcggcgccggggtggacccgaacctgccggag
cacaggcaggaggaggcgaagcgcgtgctggcgcggtgcctgcaggtgggcgtggacgcg
ctgcgctccggcgcggcggcgctggacgtcgtggaggccgtggtgcgggagctggagagc
gaccccttcttcaactccgggaggggctccgcgctcacccgcctcggcaccgtcgagatg
gaggccagcatcatggacggccgcggccgccgctgcggcgccgtctccggcgtctccacc
gtcaagaaccccgtctccctcgcccgcctcgtcatggacaagtccccccactcctacctc
gccttcgacggcgccgagcagttcgcgcgcgaccagggtctagaggtcgtcgacaacagc
tacttcatcaccgaggacaacgtcggcatgctgaagctcgccaaggaggccaacagcatc
ttgtttgactaccgtatcccgctgtccgggtcggagacgtgcggcgcacaggccgtgtcg
tcggacaacagccacggcaacggcatggtgatgaacggcctccccatcagcatctacgcg
ccagagacggtggggtgcgcggtggtggactccagcggccacaccgcggcggccacgtcc
acgggcgggctgatgaataagatgacggggcgcatcggcgactcgccgctgatcgggtcg
gggacctacgcgtgcggcgcgtgcgcggtgtcgtgcacgggggaaggcgaggccatcatc
cgctccacgctcgcgcgcgacgtcgccgccgtgatggagtacaggggcgccgggctgcag
gaggccgtcgactactgcgtcaagaagcggctcgacgaagggttcgcggggctcatcgcc
gtgtccagcacgggcgaggtggcgtacgggttcaactgcaccggcatgttcagagggtgc
gccaccgaggacggattcatggaggtcggcatctgggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340706
Entry
4340706           CDS       T01015                                 
Name
(RefSeq) asparagine synthetase [glutamine-hydrolyzing] 2
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4340706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4340706
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     4340706
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4340706
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans NAD_synthase
Other DBs
NCBI-GeneID: 4340706
NCBI-ProteinID: XP_015643183
UniProt: Q43011 V5K4S9
LinkDB
Position
6:complement(8759042..8765786)
AA seq 591 aa
MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD
QPLYNEDKSVVVTVNGEIYNHEELKANLKSHKFQTASDCEVIAHLYEEYGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFISFPPGHLY
SSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGGLDSSL
VASVVSRHLAEAKVAAQWGNKLHTFCIGLKGSPDLRAAKEVADYLGTVHHELHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKNFINVAMDIDPEWKMIKRD
LGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANEHVSDSMMMN
ASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGGPSVACSTAKAVEWDAAWSKNLD
PSGRAALGVHDAAYEDTLQKSPASANPVLDNGFGPALGESMVKTVASATAV
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgtgtggcatcctcgccgtgctcggcgtcgcagacgtctccctcgccaagcgctcccgc
atcatcgagctatcccgccggttacgtcatagaggccctgattggagtggtatacactgc
tatcaggattgctatcttgcacaccagcggttggctattgttgatcccacatccggagac
cagccgttgtacaatgaggacaaatctgttgttgtgacggtgaatggagagatctataac
catgaagaattgaaagctaacctgaaatctcataaattccaaactgctagcgattgtgaa
gttattgctcatctgtatgaggaatatggggaggaatttgtggatatgttggatgggatg
ttcgcttttgttcttcttgacacacgtgataaaagcttcattgcagcccgtgatgctatt
ggcatttgtcctttatacatgggctggggtcttgatggttcggtttggttttcgtcagag
atgaaggcattaagtgatgattgcgagcgattcatatccttcccccctgggcacttgtac
tccagcaaaacaggtggcctaaggagatggtacaacccaccatggttttctgaaagcatt
ccctccaccccgtacaatcctcttcttctccgacagagctttgagaaggctattattaag
aggctaatgacagatgtgccatttggtgttctcttgtctggtggactggactcttctttg
gttgcatctgttgtttcgcggcacttggcagaggcaaaagttgccgcacagtggggaaac
aaactgcatacattttgcattggtttgaaaggttctcctgatcttagagctgctaaggaa
gttgcagactaccttggtactgttcatcacgaactccacttcacagtgcaggaaggcatt
gatgcactggaggaagtcatttaccatgttgagacatatgatgtaacgacaattagagca
agcaccccaatgttcttgatgtcacgtaaaattaaatctttgggggtgaagatggttctt
tcgggagaaggttctgatgaaatatttggcggttacctttattttcacaaggcaccaaac
aagaaggaattccatgaggaaacatgtcggaagataaaagcccttcatttatatgattgc
ttgagagcgaacaaatcaacttctgcatggggtgttgaggcccgtgttccgttccttgac
aaaaacttcatcaatgtagctatggacattgatcctgaatggaaaatgataaaacgtgat
cttggccgtattgagaaatgggttctccggaatgcatttgatgatgaggagaagccctat
ttacctaagcacattctatacaggcaaaaggagcaattcagtgatggtgttgggtacagt
tggattgatggattgaaggatcatgcaaatgaacatgtatcagattccatgatgatgaac
gctagctttgtttacccagaaaacactccagttacaaaagaagcgtactattataggaca
atattcgagaaattctttcccaagaatgctgctaggttgacagtacctggaggtcctagc
gtcgcgtgcagcactgctaaagctgttgaatgggacgcagcctggtccaaaaaccttgat
ccatctggtcgtgctgctcttggtgttcatgatgctgcatatgaagatactctacaaaaa
tctcctgcctctgccaatcctgtcttggataacggctttggtccagcccttggggaaagc
atggtcaaaaccgttgcttcagccactgccgtttaa

DBGET integrated database retrieval system