KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332506
Entry
4332506           CDS       T01015                                 
Name
(RefSeq) asparagine synthetase [glutamine-hydrolyzing] 1
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4332506
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     4332506
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4332506
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Other DBs
NCBI-GeneID: 4332506
NCBI-ProteinID: XP_015632089
UniProt: Q10MX3
LinkDB
Position
3:complement(10120288..10124378)
AA seq 604 aa
MCGILAVLGAADWSQAKRAHVLSCSRRLKHRGPDWSGLYQCEGNFLAQQRLAIVSPLSGD
QPLYNADRTIVVVANGEIYNHKKIRKQFASKHTFSTGSDCEVIIPLYEEYGEDFVDMLDG
VFAFVLYDTRTKTYMAARDAIGVNPLYIGRGSDGAVWISSEMKALNEDCVEFEIFPPGHL
YSSAAGGLRRWYKPQWFAENVPATPYQPLLLREAFEKAVIKRLMTDVPFGVLLSGGLDSS
LVAAVTKRHLIKTEAAEKFGAELHSFVVGLEGSPDLIAAREVADHLGTIHHEFHFTVQDG
IDAIEEVIYHDETYDVTTIRASTPMFLMARKIKALGVKMVLSGEGSDELLGGYLYFHFAP
NKEEFHKETCRKVKALHQYDCLRANKATSAWGLEVRVPFLDKEFINVAMSMDPEWKMYNA
DLGRIEKWVMRKAFDDEEHPYLPKHILYRQKEQFSDGVGYNWIDGLKAFTEQQVSDEMMK
NAAKVYPHNTPVNKEAYYYRMIFERLFPQESARETVPWGPSIACSTPAAIEWVEQWKASH
DPSGRLIASHNSASASANHTNHANANANGNSNGKANGNCAMAANGTNGVGLVVANGTANG
KMEA
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtgcgggatcctggccgtgctcggcgccgccgactggtcgcaggcgaagagggctcac
gtcctctcctgctcccgcaggctgaagcacaggggacccgactggtccgggttgtaccag
tgcgagggaaacttcctcgctcagcagcgtctcgccatcgtctccccgctctccggcgac
cagccgctgtacaacgcggaccggaccatcgtcgtcgtggccaatggagagatctacaac
cacaagaagatcaggaagcagttcgcctccaagcacacgttcagcaccggcagcgactgc
gaggtcatcatcccgctgtatgaggagtacggcgaggacttcgtcgacatgctggacggc
gtgttcgccttcgtcctctacgacacccgcaccaagacgtacatggccgcccgcgacgcc
atcggcgtcaaccccctctacatcggcaggggcagcgacggcgccgtctggatatcgtcc
gagatgaaggcgctgaacgaggactgcgtggagttcgagatcttccctccgggccacctc
tactccagcgccgccggcgggctccggcggtggtacaagccgcagtggttcgccgagaac
gtcccggcgacgccgtaccagccactcctcctcagagaggccttcgagaaggccgtcatc
aagaggctcatgaccgacgtgcccttcggcgtcctcctctccggcggcctcgactcctcc
ctcgtcgccgcggtgaccaagcgccacctcatcaagactgaagccgccgagaagttcgga
gctgagctccattccttcgtcgttggccttgagggttcccctgacctgatagctgcacga
gaggtcgctgaccacctaggaaccatccatcacgagttccacttcactgtccaggatggc
atcgacgcgatcgaggaggtcatctaccacgacgagacgtacgacgtgacgacgatacgg
gccagcacgccgatgttcctgatggcgcgcaagatcaaggcgctcggggttaagatggtg
ctgtccggtgaaggctccgacgagctcctcggcggttacctctacttccacttcgccccc
aacaaggaagagttccacaaggagacctgccgcaaggtgaaagcacttcatcagtatgac
tgtctgcgtgctaacaaggcgacgtctgcctggggactggaggtccgtgtgccgttcctc
gacaaggagttcatcaacgtcgccatgagcatggaccctgagtggaagatgtacaatgct
gatcttggtcgcatcgagaagtgggttatgaggaaggcgttcgacgacgaggagcatcct
tacctgccgaagcacatactgtacaggcagaaagagcagttcagtgatggcgtcggctac
aactggatcgatggcctgaaggctttcaccgagcagcaggtcagtgatgaaatgatgaag
aacgctgccaaagtgtacccgcacaacacgcccgtcaacaaggaggcgtactactaccgc
atgatatttgagaggctcttcccgcaggaatcggcgagggagacggtgccgtggggcccg
agcatcgcgtgcagcacgccggcggcgatcgagtgggtggagcagtggaaggcgtcgcac
gacccatccggccggctgatcgcctcccacaactccgcctccgcctccgccaaccacacc
aaccacgcaaacgccaacgccaacggcaacagcaacggcaaggccaacggcaactgcgcg
atggcggccaacgggacgaacggcgtcggcctggttgtggccaacgggacagccaacggg
aagatggaagcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340706
Entry
4340706           CDS       T01015                                 
Name
(RefSeq) asparagine synthetase [glutamine-hydrolyzing] 2
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4340706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4340706
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     4340706
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4340706
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans NAD_synthase
Other DBs
NCBI-GeneID: 4340706
NCBI-ProteinID: XP_015643183
UniProt: Q43011 V5K4S9
LinkDB
Position
6:complement(8759042..8765786)
AA seq 591 aa
MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD
QPLYNEDKSVVVTVNGEIYNHEELKANLKSHKFQTASDCEVIAHLYEEYGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFISFPPGHLY
SSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGGLDSSL
VASVVSRHLAEAKVAAQWGNKLHTFCIGLKGSPDLRAAKEVADYLGTVHHELHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKNFINVAMDIDPEWKMIKRD
LGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANEHVSDSMMMN
ASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGGPSVACSTAKAVEWDAAWSKNLD
PSGRAALGVHDAAYEDTLQKSPASANPVLDNGFGPALGESMVKTVASATAV
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgtgtggcatcctcgccgtgctcggcgtcgcagacgtctccctcgccaagcgctcccgc
atcatcgagctatcccgccggttacgtcatagaggccctgattggagtggtatacactgc
tatcaggattgctatcttgcacaccagcggttggctattgttgatcccacatccggagac
cagccgttgtacaatgaggacaaatctgttgttgtgacggtgaatggagagatctataac
catgaagaattgaaagctaacctgaaatctcataaattccaaactgctagcgattgtgaa
gttattgctcatctgtatgaggaatatggggaggaatttgtggatatgttggatgggatg
ttcgcttttgttcttcttgacacacgtgataaaagcttcattgcagcccgtgatgctatt
ggcatttgtcctttatacatgggctggggtcttgatggttcggtttggttttcgtcagag
atgaaggcattaagtgatgattgcgagcgattcatatccttcccccctgggcacttgtac
tccagcaaaacaggtggcctaaggagatggtacaacccaccatggttttctgaaagcatt
ccctccaccccgtacaatcctcttcttctccgacagagctttgagaaggctattattaag
aggctaatgacagatgtgccatttggtgttctcttgtctggtggactggactcttctttg
gttgcatctgttgtttcgcggcacttggcagaggcaaaagttgccgcacagtggggaaac
aaactgcatacattttgcattggtttgaaaggttctcctgatcttagagctgctaaggaa
gttgcagactaccttggtactgttcatcacgaactccacttcacagtgcaggaaggcatt
gatgcactggaggaagtcatttaccatgttgagacatatgatgtaacgacaattagagca
agcaccccaatgttcttgatgtcacgtaaaattaaatctttgggggtgaagatggttctt
tcgggagaaggttctgatgaaatatttggcggttacctttattttcacaaggcaccaaac
aagaaggaattccatgaggaaacatgtcggaagataaaagcccttcatttatatgattgc
ttgagagcgaacaaatcaacttctgcatggggtgttgaggcccgtgttccgttccttgac
aaaaacttcatcaatgtagctatggacattgatcctgaatggaaaatgataaaacgtgat
cttggccgtattgagaaatgggttctccggaatgcatttgatgatgaggagaagccctat
ttacctaagcacattctatacaggcaaaaggagcaattcagtgatggtgttgggtacagt
tggattgatggattgaaggatcatgcaaatgaacatgtatcagattccatgatgatgaac
gctagctttgtttacccagaaaacactccagttacaaaagaagcgtactattataggaca
atattcgagaaattctttcccaagaatgctgctaggttgacagtacctggaggtcctagc
gtcgcgtgcagcactgctaaagctgttgaatgggacgcagcctggtccaaaaaccttgat
ccatctggtcgtgctgctcttggtgttcatgatgctgcatatgaagatactctacaaaaa
tctcctgcctctgccaatcctgtcttggataacggctttggtccagcccttggggaaagc
atggtcaaaaccgttgcttcagccactgccgtttaa

DBGET integrated database retrieval system