KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332529
Entry
4332529           CDS       T01015                                 
Name
(RefSeq) ubiquitin-activating enzyme E1 3
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4332529
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332529
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     4332529
Ubiquitin system [BR:osa04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   4332529
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4332529
  Exosomal proteins of other body fluids (saliva and urine)
   4332529
  Exosomal proteins of colorectal cancer cells
   4332529
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_UFD E1_4HB
Other DBs
NCBI-GeneID: 4332529
NCBI-ProteinID: XP_015632802
UniProt: Q10MU6 Q0DSQ3
LinkDB
Position
3:complement(10298984..10305416)
AA seq 1064 aa
MLPTKRANGAEAESSSDAPAKKARVGASASEAEAMVAGEAGGGGGGVSGNGSEVAEIDED
LHSRQLAVYGRETMRRLFASNVLVSGLNGLGAEIAKNLALAGVKSITLHDMGNVEMWDLS
GNFFLSEDDIGKNRAVACTAKLQELNNAVLISTLTEDLTNEHLSKFQAVVFTDISLDKAF
EFDDYCRNHQPSISFIKAEVCGLFGSVFCDFGPKFTVLDVDGEEPHTGIIASISNDNPAM
ISCVDDERLEFQDGDLVVFSEVQGMTELNDGKPRKIINARPYSFCIQEDTSKFGIYAKGG
IVTQVKEPINLEFKSLRDSIREPGNFLLSDFSKFDRPPLLHFAFLALDKFRKEFGRFPGA
GCDQDAQRFIEFVASVNEATIDYKMDELDGKLLRNFASGSRAVLNPMAAMFGGIVGQEVV
KACSGKFHPQYQFFYFDSAESLPTYPLDSKDLKPLNSRYDAQISVFGSKLQKKMRDANVF
VVGSGALGCEFLKNLALMGVSCGLKGKLTITDDDIIEKSNLSRQFLFRDWNIGQAKSTVA
AAAASAINSSLHINALQNRACPETEHVFHDKFWEGLDVIINALDNVNARMYMDMRCLYFQ
KPLLESGTLGPKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEF
EGLLEKTPNEVNSFISNPAQYAAAMRKAGDAQARELLERVCECLDKERCDGFEDCIAWAR
LKFEDYFANRVKQLTFTFPEDAVTSTGAFFWSAPKRFPRPLQFSTVNSSHIHFILAASIL
RAVSFGISIPDWAKNTSNLVDAVSKVVVPEFEPKSGVKIETDEKASNISSASVDDASVIE
DLLTKLEASAKKLPPGFQMKAIQFEKDDDTNFHMDLIAGLANMRARNYGIQEVDKLKAKF
IAGRIIPAIATSTAMATGLVCLELYKVLAGGHPVEDYRNSFANLAIPMFSMAEPLPPKVI
KHQDMRWTIWDRWSIEGNITVAELLKWLSDKGLSAYSVSCGTSLLYNTMFPRHKDRVNKK
LVDVAKEVAKVDVPAYRRHLDVVVACEDDDGNDVDIPLISIYFR
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcttccgacgaagagagcgaacggcgctgaggctgagagcagcagcgacgcgccggcg
aagaaggcgcgggtaggggcatcggcgtcggaggcggaggcgatggtggctggggaggcg
ggcggcggtgggggtggggtgagcggcaatgggagcgaggtggcggagatcgacgaggac
ctgcacagcaggcagctcgccgtgtacgggagggagacgatgcggcggctcttcgcgtcc
aacgtcctcgtctccggactgaacgggcttggggctgagattgcgaagaatcttgcttta
gcgggtgttaagtctatcaccctacatgatatgggaaatgtggaaatgtgggacttatca
ggcaatttcttcctatctgaagatgatattggaaagaatagggctgttgcttgcactgca
aagctgcaagaactcaacaatgctgttcttatatctactctgacagaagatctgaccaat
gaacacctctcaaagtttcaggctgttgttttcactgacataagtctagacaaggcgttt
gaatttgatgattattgtcgtaaccaccagccttcaatttcttttatcaaagcagaagtt
tgtggtctttttggtagtgtattttgtgactttgggcctaagtttaccgttctggatgtt
gatggtgaagaaccacatactggtataattgcatccatcagcaatgacaatcctgcaatg
atatcctgcgttgatgatgagcgccttgaattccaagatggtgatcttgttgtcttctca
gaggtccaagggatgacagaactaaatgatggcaagccaaggaagataataaatgcaagg
ccatattcattttgcatccaggaggatacaagtaaatttggtatttatgcaaaaggtgga
attgttactcaggtgaaagagccgatcaacttagagttcaagagtctcagagattctata
agagaaccagggaatttccttttgagcgatttctcaaagtttgaccgtcctcctcttctg
cacttcgcatttctagctttggataagttcaggaaagaatttgggcgctttcctggtgct
ggctgtgaccaagatgctcaaaggtttattgagtttgttgcttctgtcaatgaagctaca
attgattacaagatggatgagcttgatgggaagttgttacgaaattttgcaagtggttct
agagctgttctaaacccaatggctgcgatgtttggtggcattgtcggccaagaagttgtt
aaggcatgctctgggaaatttcatcctcaataccagttcttttattttgattcagcggaa
tctctaccaacctatccattggactcaaaagacttgaaaccattgaatagccgctatgat
gctcagatatctgtttttggttctaagcttcagaaaaagatgagagatgccaatgttttt
gttgtgggatctggtgctcttgggtgtgaattcttgaagaatcttgctttaatgggagta
tcttgtggccttaaaggaaagctaactataacagatgatgatatcattgagaaaagcaac
ttgagccgccaatttctgtttcgtgattggaatattgggcaggctaaatctactgtagca
gctgcagcggctagtgctatcaactccagcctgcatattaatgctcttcagaatcgtgcc
tgtccagagactgagcatgtgttccatgacaaattctgggagggccttgatgtcatcatc
aatgcacttgataatgttaatgctaggatgtacatggatatgagatgcttgtacttccag
aaaccacttttggaatctggaacattgggtccaaaatgcaatacacaaatggtaattcct
caccttactgaaaactatggagcatcccgagaccctcctgagaaacaggcaccaatgtgc
acagtccactctttcccacacaatattgaccactgtctgacatgggctcgttcagagttt
gagggtttgctagagaaaactccaaatgaagtgaactcttttatttccaatccagctcaa
tatgctgctgctatgagaaaggcaggtgatgctcaagcaagggaattgctcgagcgtgtt
tgtgaatgccttgacaaggagcgatgtgatggatttgaagattgcattgcctgggctaga
ctgaaatttgaagactacttcgctaatcgtgtgaagcagctaacattcacatttcctgaa
gatgcggtcactagcacgggtgcttttttctggtctgcccccaaacggtttcctcgccca
ctgcaattctctactgtgaattcatctcacattcacttcatactggctgcttccatattg
agagcagtgtcattcgggatctccatacccgactgggcaaagaacacaagtaatctggtc
gatgctgttagtaaggttgtagtgcctgaatttgaaccgaagagtggggttaagattgag
acagatgagaaagcttctaacatctctagtgcttctgttgatgatgcttctgttattgaa
gatcttttaaccaagctggaagcatctgcaaaaaaattacctcctggattccagatgaag
gctattcagtttgagaaggatgatgacacaaacttccacatggatttaattgctgggctt
gcaaatatgcgtgcaaggaactatggtattcaagaggtcgacaagctgaaggcgaagttc
attgcaggaagaatcattccggcgatcgcaacttcgacagccatggcaacaggacttgtg
tgccttgagctttacaaggttctggctggtgggcaccccgtcgaagactaccgcaattcg
tttgctaacttggcaataccaatgttctccatggctgaacctcttccacccaaggtgatc
aagcatcaagacatgagatggaccatatgggatcggtggtctatcgagggcaacatcact
gtcgcagaactcctcaagtggctgagtgacaagggcctgagcgcgtacagtgtctcctgc
ggcacttcattgctttacaacaccatgtttccgagacacaaggatcgagtgaacaagaag
ctcgtggatgtcgccaaggaggtggcgaaggtggacgttccggcatacaggaggcacctg
gatgtcgtcgttgcctgtgaagatgatgatgggaatgacgtcgacatccctctcatctcc
atttacttccggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344380
Entry
4344380           CDS       T01015                                 
Name
(RefSeq) ubiquitin-activating enzyme E1 3 isoform X1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4344380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4344380
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344380
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     4344380
Ubiquitin system [BR:osa04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   4344380
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4344380
  Exosomal proteins of other body fluids (saliva and urine)
   4344380
  Exosomal proteins of colorectal cancer cells
   4344380
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_4HB E1_UFD
Other DBs
NCBI-GeneID: 4344380
NCBI-ProteinID: XP_015647669
LinkDB
Position
7:29478763..29483638
AA seq 1058 aa
MRCLRFLRRGLLSMLPTNKRAAGTDDDRPTDPKRPKVAQNGSTNGVVVPEIDEDLHSRQL
AVYGRETMRRLFASHVLVSGLNGLGAEIAKNLALAGVKSVTLHDVKNVEMWDLSANFFLS
ENDIGKNRAAACVSKLQELNNAVLVSALTEELTTDHLSKFQAVVFTDIGLDKAYEFDDYC
HSHCPPISFIKAEVCGLFGTVFCDFGPEFTVLDVDGEDPHTGIIASISNDNPALVSCVDD
ERLEFQDGDFVVFSEVHGMAELNDGKPRKVKNARPFSFCIEEDTTKYDMYIKGGIVTQIK
EPKILRFKSLRDAMRDPGDFLLSDFSKFERSPVLHLAFQALDKFKKEYGRYPAPGCEQDA
QSFLKCAADINEALTDHKLDTIDEKLFRHFASGSRAVLNPMAAMFGGIVGQEVVKACSGK
FHPLYQFFYFDSVESLPTYPLDSEDIKPSNSRYDAQISVFGSKLQKKLEEANTFVVGSGA
LGCEFLKNLALMGVSCSPKGKLTITDDDVIEKSNLSRQFLFRDWNIRQAKSTVAAAAASA
INPNLCIDALQNRACPDTENVFHDTFWEGLDVVINALDNVNARMYMDMRCLYFQKALLES
GTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEK
TPGEVNSFLSNPAQYAAAMRKAGDAQARELLERVSECLGKERCSLFEDCIRWARLKFEDY
FSNRVKQLTFTFPEDAATSTGAPFWSAPKRFPRPLQFSVSDPSHIHFIMSASILRAESFG
IAIPDWAKNTSKLADAVSEVAVPQFEPKKGVSIVTDEKATSLSSASVDDVSVIDDLLAKL
EECAKRLPPGFQMKPIQFEKDDDTNFHMDLISGFANMRARNYSIPEVDKLKAKFIAGRII
PAIATSTAMATGLVCLELYKVIAGEHPIEDYRNTFANLALPLFSMAEPVPPKVMKHQDMS
WTVWDRWSIKGNLTVAELLQWFSDKGLTAYSISCGTSLLYNNMFARHKERLNKKVVDVAR
EVAKVDVPEYRKHLDLVAACEDDDGNDIDIPLVSVYFR
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgaggtgcttacggtttctgcgcaggggcttgctctccatgcttcccaccaacaagaga
gccgccggcacggacgacgaccgccccaccgaccccaagagacccaaggtcgcccaaaac
gggagcacgaatggagtggtggtgccggagattgacgaggacctgcacagcaggcagctc
gccgtctacgggagggagaccatgcgccgcctcttcgcctcccatgtcctcgtctctggc
ctcaatggcctcggtgcagagattgccaagaaccttgctcttgctggggtcaagtccgtc
accctacatgatgtgaaaaacgttgagatgtgggatttgtctgccaatttctttttatct
gaaaatgatattggcaaaaacagggctgctgcttgtgtatccaagctgcaagagctcaac
aatgctgttcttgtctctgctctaacagaggaactgaccacagaccacctgtctaaattc
caggctgttgttttcaccgatataggtttagacaaggcctacgaatttgatgactactgt
cacagccactgccctcctatttccttcatcaaagctgaagtttgtggtctctttggtact
gtcttttgtgactttggaccagagtttaccgttcttgatgttgatggtgaagacccacat
actggtataattgcatccatcagcaatgacaaccctgcgttggtgtcctgtgtagatgat
gaacggcttgagtttcaggacggtgattttgtggttttctctgaggtccatggtatggct
gagttaaatgatggaaaaccaaggaaggttaaaaatgcaaggccattttcattttgcatt
gaggaagatacaactaaatatgacatgtatataaaaggtggaatcgttacacagatcaag
gagccaaagatactacgattcaagtcactaagagatgctatgagagatcctggagatttc
cttctgagtgacttctctaagtttgaacgttcccccgtgcttcacctagcatttcaagct
ctggataagtttaagaaagaatatggacgctaccctgctcctggttgtgagcaggatgct
caaagtttccttaagtgtgctgctgatattaacgaagccttaactgatcacaagctggat
acaattgatgagaagttattcagacatttcgcaagtggttctcgagctgttttgaaccct
atggctgcaatgtttggtggtattgttggtcaagaagttgtgaaggcatgttcaggaaaa
ttccatcctctctaccagttcttctactttgattctgtcgaatccctgccaacgtatcca
cttgactctgaagacatcaaaccgtcaaacagccgctatgatgctcagatctctgtattt
ggttccaaacttcagaagaaactggaagaggcaaatacttttgttgtggggtctggtgcc
cttggatgtgaatttttgaagaaccttgctttaatgggagtgtcttgcagccctaaggga
aagctaactataacagatgatgatgtcattgagaaaagtaatttaagccgccaatttctg
ttccgtgactggaatatcaggcaggcaaagtctactgtggccgctgcagctgccagtgct
atcaaccccaacctctgtattgatgctctccagaaccgtgcttgtccagatacagagaat
gtgttccatgacacgttctgggagggtttagatgttgtcatcaatgcgcttgataatgtt
aatgccaggatgtatatggacatgagatgcctgtacttccagaaggcattgttggagtca
ggaacattgggtgcaaagtgcaatacgcaaatggtgattcctcaccttactgaaaattat
ggggcttcaagagatcctccagagaagcaggcaccaatgtgcacagtccattcttttccg
cacaatattgatcattgcttgacttgggcacgctctgagtttgagggtttgctagagaag
acaccaggtgaagtaaattcatttctctctaatccggctcaatatgctgctgccatgagg
aaggcaggtgatgcccaagctagagaattgctcgagcgtgtttctgaatgtcttggcaaa
gagcgttgcagtttgtttgaggattgcataagatgggccagactgaaatttgaggactat
ttctcaaaccgtgtgaagcagctcacatttacctttcctgaagatgctgccactagtacg
ggtgctcctttctggtctgcccccaagcgcttccctcgcccactgcaattttcagtctct
gatccctcccacattcactttattatgtctgcttcaatactgagagctgagtcatttgga
attgctataccggactgggcaaagaacacaagtaagctggctgatgcagtaagtgaagtt
gccgttcctcaatttgagccaaagaaaggggtcagtattgtgacagatgagaaagctact
agcctttccagtgcctcagttgatgatgttagtgttattgatgaccttcttgctaagttg
gaagaatgtgccaagaggttacctccaggattccaaatgaaacctatccaatttgagaag
gatgatgacaccaactttcacatggatctgatctctggatttgcaaatatgcgcgcaagg
aactacagcattccagaggttgacaaattgaaggctaagttcattgctggaagaatcatc
ccagctattgcaacttcaacagcgatggcgacaggactggtctgtcttgagctatacaag
gttattgctggcgagcaccccattgaagactaccgcaatacatttgcgaacctggcactg
ccactattctcaatggctgaacctgttccacccaaggtgatgaagcatcaagacatgagc
tggactgtatgggacagatggtccatcaagggcaatctgactgttgctgagctcctgcaa
tggttcagcgacaagggccttaccgcttacagcatttcctgtggcacttcgctgctgtac
aacaacatgttcgcaagacacaaggagagattgaacaagaaggtggtagacgtggccaga
gaagtcgccaaggtggatgttcctgaatacaggaagcatttggatcttgtggcggcctgc
gaggatgatgatggaaacgacatcgatattcctcttgtctcagtttacttccgatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349557
Entry
4349557           CDS       T01015                                 
Name
(RefSeq) ubiquitin-activating enzyme E1 2
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4349557
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4349557
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349557
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     4349557
Ubiquitin system [BR:osa04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   4349557
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4349557
  Exosomal proteins of other body fluids (saliva and urine)
   4349557
  Exosomal proteins of colorectal cancer cells
   4349557
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_UFD E1_4HB
Other DBs
NCBI-GeneID: 4349557
NCBI-ProteinID: XP_015616970
UniProt: Q2RBM4 Q0IV81
LinkDB
Position
11:complement(295748..301638)
AA seq 1048 aa
MLTRKREELAGEVHDLHKKTRADDEPADDNHTMTTGRAPEIDEDLHSRQLAVYGRETMKR
LFASNVLVSGLNGLGAEIAKNLVLAGVKSVNLHDDDNVELWDLSSNFFLTEKDVGQNRAQ
TCVQKLQELNNAVIISTITGDLTKEQLSNFQAVVFTDISLEKAVEFDSYCHNHQPPIAFI
KSEIRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISNDNPALVSCVDDERLEFQDGDL
VVFSEVHGMSELNDGKPRKIKNARPYSFTLEEDTTSYGTYVRGGIVTQVKPPKVLKFKTL
KDAIKEPGEFLMSDFSKFDRPPLLHLAFQALDKFRNDLRRFPIAGSSDDVQRLIDFAISI
NESLGDSKLEELDKKLLHHFASGSRAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYF
DSVESLPVEPLEPAELKPENTRYDAQISVFGSNLQKKLEQAKIFMVGSGALGCEFLKNLA
LMGISCNQNGKLIVTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMAINPKLHVEAL
QNRASPETENVFNDAFWESLDAVVNALDNVTARMYIDSRCVYFQKPLLESGTLGAKCNTQ
MVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPTEVNAFLS
NPGGYATVARTAGDAQARDQLERVIECLEREKCETFQDCITWARLKFEDYFSNRVKQLTY
TFPEDAMTSSGAPFWSAPKRFPRPLEFLTSDPSQLNFILAAAILRAETFGIPIPDWVKNP
AKMAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEELIAKLEAISKTLQPG
FQMKPIQFEKDDDTNYHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMA
TGLVCLELYKVLGGGHKVEDYRNTFANLAIPLFSMAEPVPPKTIKHQDMAWTVWDRWTIT
GNITLRELLDWLKEKGLNAYSISCGTSLLYNSMFPRHKERLDKKVVDVAREVAKVEVPPY
RRHLDVVVACEDDDDNDVDIPLVSIYFR
NT seq 3147 nt   +upstreamnt  +downstreamnt
atgcttacccgcaagcgggaggagctcgccggcgaggtccacgacttgcacaagaagacc
cgcgccgacgacgaacccgccgacgacaaccacaccatgaccaccggcagagcgcccgag
atcgatgaggacctccacagccgccagctcgccgtctatggccgcgagaccatgaagcgc
ctcttcgcctccaacgtcctcgtctctggcctcaacggcctcggcgccgagatcgccaag
aaccttgtccttgcgggtgtcaagtccgtaaacttgcacgatgatgacaatgtggagcta
tgggacttatcaagcaacttcttcctcacagagaaggatgttggtcaaaaccgtgctcaa
acttgtgttcagaagctacaggagctcaataatgctgttattatctctactataaccggt
gatttgactaaggagcagctttctaatttccaggctgtggtctttactgatatcagctta
gagaaagcagttgagtttgacagttactgccacaaccatcagccaccaattgctttcatt
aagtcagaaattcgtggcctttttggcagtgtcttttgtgactttggtcctgagtttact
gtattggatgttgatggagaggagccacatacaggaatagtagcatcgatcagcaatgac
aaccctgcgcttgtttcctgtgttgatgatgagcgtctggagttccaggatggtgattta
gttgtgttctcagaagtccatggaatgagtgaactaaatgatgggaaaccaagaaagatt
aagaacgctaggccttattcttttactctagaagaagacactacctcatatgggacatat
gttagaggtggtattgttactcaggtcaagccaccaaaggttcttaaattcaaaaccttg
aaagacgccattaaggaaccaggagaatttctcatgagcgatttctccaaattcgaccgt
ccaccacttctgcatttggctttccaagctttggataagtttaggaatgatttgaggcga
ttccctattgctgggtctagtgatgatgtgcaaagactgatagattttgctattagcatt
aacgagtccctgggtgatagcaaacttgaagagctcgacaaaaagctcctgcatcatttt
gcaagtggttccagggctgttctgaaccctatggctgcaatgtttggtggcattgtaggt
caagaggttgtgaaagcatgctcagggaaattccatccactttaccagttcttctatttt
gattctgttgaatctctccctgttgaaccattggagccagccgagttgaagccagagaat
actagatatgatgcacaaatcagtgtttttggatctaaccttcaaaagaaacttgagcag
gcgaaaatatttatggttggttctggggcgcttggatgtgagttcttgaaaaacctagcg
ctaatgggcatttcttgcaatcagaatggaaagctgatagtgacagatgatgatgttatt
gaaaaaagcaatctcagtcgccagtttctcttccgtgactggaacattggtcagcccaag
tccacggttgctgctactgctgctatggcaattaatcctaagcttcatgtcgaggccctt
cagaacagagcaagtcctgagactgaaaatgtgttcaacgatgccttttgggagagcctg
gatgctgttgtcaatgcgttggacaatgttaccgcaagaatgtatattgactcccgatgt
gtatatttccagaagccactcttggaatctgggactctgggtgctaaatgtaacacacag
atggtcatacctcacctaacagagaactatggcgcatccagagatccacctgaaaagcag
gcgccgatgtgtactgtacattcatttcctcataatattgatcattgcctaacctgggct
aggtctgagtttgagggtttgcttgagaagacccccactgaagtaaatgccttcctatcg
aatcctggtggatatgcaactgtagcaagaactgctggtgatgcacaggctagggatcag
cttgagcgcgttattgaatgtctcgagagagagaagtgtgagacattccaagattgtatt
acctgggcccggctcaagtttgaggattatttctccaaccgtgtgaagcaactgacatac
actttccctgaagatgcgatgaccagctctggtgctcctttctggtctgctccaaagcgt
ttcccacgaccactggagttcttgacatctgatccaagccagcttaactttattttggct
gctgcaattttaagggcagagacatttgggatacccatacctgactgggtcaaaaaccca
gcaaagatggctgaagctgttgacaaggtgattgttcctgatttccaaccaaaacagggg
gttaagatagttacagatgagaaggctactagtctttcgtctgcatctgttgatgatgct
gctgtcattgaagagcttattgcaaagttagaagcaatttccaaaacactgcaaccagga
ttccagatgaaaccaatccagtttgagaaggatgatgacaccaattaccatatggacgtg
atagctggttttgctaacatgcgggcaaggaactatagcattcctgaagtggacaagctg
aaggcgaagttcatagctggcaggatcatccctgccattgccacctcaactgcgatggct
actggtcttgtctgcttggaactgtacaaggtactcggtggtgggcacaaggttgaagac
tacaggaacacatttgcaaaccttgcaatccccctcttctctatggctgagccggtccct
cccaagaccatcaagcaccaggacatggcctggactgtttgggaccgctggaccataact
ggcaacatcacgctgagggagcttctggactggctcaaggagaagggcctgaatgcatac
agcatatcttgcggcacctcgctgctgtacaactcaatgttcccgaggcacaaggagcgt
ctagacaagaaggtggtcgatgtggcgagggaggtggcaaaggtggaggtgcccccatac
cggcgccatcttgacgtggtggtggcttgtgaggacgatgatgacaacgacgttgacatc
ccactggtatcaatctacttccggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271171
Entry
9271171           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ubiquitin-activating enzyme E1 2
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9271171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    9271171
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9271171
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     9271171
Ubiquitin system [BR:osa04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   9271171
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9271171
  Exosomal proteins of other body fluids (saliva and urine)
   9271171
  Exosomal proteins of colorectal cancer cells
   9271171
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_UFD E1_4HB
Other DBs
NCBI-GeneID: 9271171
NCBI-ProteinID: XP_015619764
LinkDB
Position
12:complement(312852..318614)
AA seq 1003 aa
MLTRKREDLAGEVVHDLHKKTRADDEPADDNHTMTTGRAPEIDEDLHSRQLAVYGRETMK
RLFASNVLVSGLNGLGAEIAKNLVLAGVKSVTLHDDDNVELWDLSSNFFLTEKDVGQNRA
QTCVQKLQELNNAVIISTITGDLTKEQLSNFQAVVFTDISLEKAVEFDSYCHNHQPPIAF
IKSEIRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISNDNPALVSCVDDERLEFQDGD
LVVFSEVHGMSELNDGKPRKIKNARPYSFTLEEDTTSYGTYVRGGIVTQVKPPKVLKFKT
LKDAIKEPGEFLMSDFSKFDRPPLLHLAFQALHHFASGSRAVLNPMAAMFGGIVGQEVVK
ACSGKFHPLYQFFYFDSVESLPVEPLEPAELKPENTRYDAQISVFGSNLQKKLEQAKIFM
VGSGALGCEFLKNLALMGISCNQNGKLTVTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAA
TAAMAINPKLHVEALQNRASPETENVFNDAFWESLDAVVNALDNVTARMYIDSRCVYFQK
PLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFE
GLLEKTPTEVNAFLSNPGGYATVARTAGDAQARDQLERVIECLEREKCETFQDCITWARL
KFEDYFSNRVKQLTYTFPEDAMTSSGAPFWSAPKRFPRPLEFLTSDPSQLNFILAAAILR
AETFGIPIPDWVKNPAKMAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEE
LIAKLEAISKTLQPGFQMKPIQFEKDDDTNYHMDVIAGFANMRARNYSIPEVDKLKAKFI
AGRIIPAIATSTAMATGLVCLELYKVLGGGHKVEDYRNTFANLAIPLFSMAEPVPPKTIK
HQDMAWTVWDRWTITGNITLRELLDWLKEKGLNAYSISCGTSLLYNSMFPRHKERLDKKV
VDVAREVAKVEVPPYRRHLDVVVACEDDDDNDVDIPLVSIYFR
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgcttacccgcaagcgggaggatctcgccggcgaggtcgtccacgacttgcacaagaag
acccgcgccgacgacgaacccgccgacgacaaccacaccatgaccaccggcagagcgccc
gagatcgatgaggaccttcacagccgccagctcgccgtctatggccgcgagaccatgaag
cgcctcttcgcctccaacgtcctcgtctctggcctcaacggcctcggcgccgagatcgcc
aagaaccttgtccttgcgggtgtcaagtccgtaaccttgcacgatgatgacaatgtggag
ctatgggacttatcaagcaacttcttcctcacagagaaggatgttggtcaaaaccgtgct
caaacttgtgttcagaagctacaggagctcaataatgctgttattatctctactataacc
ggtgatttgactaaggagcagctttctaatttccaggctgtggtctttactgatatcagc
ttagagaaagcagttgagtttgacagttactgccacaaccatcagccaccaattgctttc
attaagtcagaaattcgtggcctttttggcagtgtcttttgtgactttggtcctgagttt
actgtattggatgttgatggagaggagccacatacaggaatagtagcatcgatcagcaat
gacaaccctgcgcttgtttcctgtgttgatgatgagcgtctggagttccaggatggtgat
ttagttgtgttctcagaagtccatggaatgagtgaactaaatgatgggaaaccaagaaag
attaagaacgctaggccttattcttttactctagaagaagacactacctcatatgggaca
tatgttagaggtggtattgttactcaggtcaagccaccaaaggttcttaaattcaaaacc
ttgaaagacgccattaaggaaccaggagaatttctcatgagcgatttctccaaattcgac
cgtccaccacttctgcatttggctttccaagctctgcatcattttgcaagtggttccagg
gctgttctgaaccctatggctgcaatgtttggtggcattgtaggtcaagaggttgtgaaa
gcatgctcagggaaattccatccactttaccagttcttctattttgattctgttgaatct
ctccctgttgaaccattggagccagccgagttgaagccagagaatactagatatgatgca
caaatcagtgtttttggatctaaccttcaaaagaaacttgagcaggcgaaaatatttatg
gttggttctggggcgcttggatgtgaattcttgaaaaacctagcactaatgggcatttct
tgcaatcagaatggaaagctgacagtgacagatgatgatgttattgaaaagagcaatctc
agtcgccagtttctcttccgtgactggaacattggtcagcccaagtccacggttgctgct
actgctgctatggcaattaatcctaagcttcatgtcgaggcccttcagaacagagcaagt
cctgagactgaaaatgtgttcaacgatgccttttgggagagcctggatgctgttgtcaat
gcgttggacaatgttaccgcaagaatgtatattgactcccgatgtgtatatttccagaag
ccactcttggaatctgggactctgggtgctaaatgtaacacacagatggtcatacctcac
ctaacagagaactatggcgcatccagagatccacctgaaaagcaggcgccgatgtgtact
gtacattcatttcctcataatattgatcattgcctaacctgggctaggtctgagtttgag
ggtttgcttgagaagacccccactgaagtaaatgccttcctatcgaatcctggtggatat
gcaactgtagcaagaactgctggtgatgcacaggctagggatcagcttgagcgcgttatt
gaatgtctcgagagagagaagtgtgagacattccaagattgtattacctgggcccggctc
aagtttgaggattatttctccaaccgtgtgaagcaactgacatacactttccctgaagat
gcgatgaccagctctggtgctcctttctggtctgctccaaagcgtttcccacgaccactg
gagttcttgacatctgatccaagccagcttaactttattttggctgctgcaattttaagg
gcagagacatttgggatacccatacctgactgggtcaaaaacccagcaaagatggctgaa
gctgttgacaaggtgattgttcctgatttccaaccaaaacagggggttaagatagttaca
gatgagaaggctactagtctttcgtctgcatctgttgatgatgctgctgtcattgaagag
cttattgcaaagttagaagcaatttccaaaacactgcaaccaggattccagatgaaacca
atccagtttgagaaggatgatgacaccaattaccatatggacgtgatagctggttttgct
aacatgcgggcaaggaactatagcattcctgaagtggacaagctgaaggcgaagttcata
gctggcaggatcatccctgccattgccacctcaactgcgatggctactggtcttgtctgc
ttggaactgtacaaggtactcggtggtgggcacaaggttgaagactacaggaacacattt
gcaaaccttgcaatccccctcttctctatggctgagccggtccctcccaagaccatcaag
caccaggacatggcctggactgtttgggaccgctggaccataactggcaacatcacgctg
agggagcttctggactggctcaaggagaagggcctgaatgcatacagcatatcttgcggc
acctcgctgctgtacaactcaatgttcccgaggcacaaggagcgtctagacaagaaggtg
gtcgatgtggcgagggaggtggcaaaggtggaggtgcccccataccggcgccatcttgac
gtggtggtggcttgtgaggacgatgatgacaacgacgttgacatcccactggtatcaatc
tacttccggtga

DBGET integrated database retrieval system