KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332545
Entry
4332545           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S7-like
  KO
K02993  small subunit ribosomal protein S7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332545
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4332545
SSDB
Motif
Pfam: Ribosomal_S7e
Other DBs
NCBI-GeneID: 4332545
NCBI-ProteinID: XP_015631394
UniProt: A3AH06 Q10MS5
LinkDB
Position
3:10393571..10395750
AA seq 192 aa
MYTARKKIQKEKGLEPSEFEDSVAQAFFDLENGNQELKSELKDLYINNAVQMDIAGNRKA
VVIHVPYRLRKAFKKIHVRLVRELEKKFSGKDVVIVATRRIVRPPKKGSAVQRPRTRTLT
AVHDGILEDVVYPAEIVGKRIRYRLDGAKVIKIFLDPKERNNTEYKLETFSAVYRRLCGK
DVAFEYPMTETA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtacaccgcgaggaagaagatccagaaggagaagggcctcgagccctccgagttcgag
gactccgtcgcgcaggctttctttgacctcgagaatggcaaccaggagctcaagagcgag
ctcaaggacctgtacatcaacaatgcagtccagatggatattgccgggaacaggaaggct
gtggtgatccacgtgccgtaccgtctgcgcaaggcattcaagaaaatccatgtcaggctt
gtcagggagctcgagaagaagttcagcggcaaggatgtggtaattgttgcaacaaggagg
attgtgaggcctcccaagaagggctcggctgttcagcgccctcgcacaagaactcttact
gctgttcatgatggtatcttggaggatgtagtctacccagctgagattgttggcaagcgc
atcagataccgtctggatggtgccaaggtcatcaagattttcttggacccaaaggagcgc
aacaataccgaatacaagctcgagaccttctccgcggtctaccgcaggctttgtgggaaa
gatgttgcctttgagtaccctatgactgaaactgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332546
Entry
4332546           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S7-like
  KO
K02993  small subunit ribosomal protein S7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332546
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4332546
SSDB
Motif
Pfam: Ribosomal_S7e
Other DBs
NCBI-GeneID: 4332546
NCBI-ProteinID: XP_015631395
UniProt: A0A8J8YQ41 Q10MS4
LinkDB
Position
3:10393578..10400009
AA seq 192 aa
MYTARKKIQKEKGLEPSEFEDSVAQAFFDLENGNQELKSELKDLYINNAVQMDIAGNRKA
VVIHVPYRLRKAFKKIHVRLVRELEKKFSGKDVVIVATRRIVRPPKKGSAVQRPRTRTLT
AVHDCILEDVVYPAEIVGKRIRYRLDGAKVIKIFLDPKERNNTEYKLETFSAVYRRLCGK
DVAFEYPMTETA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtacaccgcgaggaagaagatccagaaggagaagggcctcgagccctccgagttcgag
gactccgtcgcgcaggctttctttgacctcgagaatggcaaccaggagctcaagagcgag
ctcaaggacctgtacatcaacaatgcagtccagatggatattgccgggaacaggaaggct
gtggtgattcacgtgccgtaccgtctgcgcaaggcattcaagaaaatccatgtcaggctt
gtcagggagctcgagaagaagttcagcggcaaggatgtggtgattgttgcaacaaggagg
attgtgaggcctcccaagaagggctcggctgttcagcgccctcgcacaagaactcttacc
gctgttcatgattgtatcttggaggatgtagtctacccagctgagattgttggcaagcgc
atcagataccgtctggatggtgccaaggtcatcaagattttcttggacccaaaggagcgc
aacaataccgaatacaagcttgagaccttctccgcagtctaccgcaggctttgtgggaaa
gatgttgccttcgagtaccctatgactgaaactgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338485
Entry
4338485           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S7
  KO
K02993  small subunit ribosomal protein S7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338485
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4338485
SSDB
Motif
Pfam: Ribosomal_S7e DNA_pol3_delta
Other DBs
NCBI-GeneID: 4338485
NCBI-ProteinID: XP_015639953
UniProt: Q8LJU5
LinkDB
Position
5:complement(16302892..16306178)
AA seq 192 aa
MYTARRKIQKDKGLEPTEFEDTVAQAFFDLENGNQELKSDLKDLYINGAVQMDLPGNRKA
VIIYVPYRLRKAYKKIHVRLVRELEKKFSGKDVVLVATRRIVRPPKKGSAVVRPRTRTLT
AVHDGILEDVVYPAEIVGKRVRYHLDGRKIMKIFLDPKERNNTEYKLDTFSSVYRRLCGK
DVVFDYPMTETA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtatacagcaaggaggaagatccagaaggacaagggtctggagccaactgagtttgag
gacactgttgctcaggcattttttgaccttgagaatgggaatcaggagctgaagagtgac
ttgaaggacctttacatcaatggagcagttcagatggatttacctggcaacaggaaggct
gttattatttatgttccatacaggctgcggaaggcatataagaagatccatgtgaggctt
gttagggaacttgagaagaaattcagtgggaaggatgtggttctggttgcaactagaaga
atagtgaggcccccaaagaaaggctcagctgttgttcgccctcgtacccgcacacttact
gctgttcatgatggcatcttggaggatgttgtgtatccagcagagattgttgggaagcgt
gtcagataccacttggatggtagaaaaatcatgaagatcttcctggacccaaaggagcgc
aacaacaccgagtacaagctcgacactttcagctctgtctacaggaggctctgtgggaag
gacgtcgtgttcgactaccccatgaccgagactgcgtaa

DBGET integrated database retrieval system