KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332553
Entry
4332553           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 4 homolog
  KO
K03062  26S proteasome regulatory subunit T2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4332553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4332553
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4332553
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_22 DUF815 AAA_2 AAA_5 AAA_16 RuvB_N ATPase AAA_3 TIP49 RNA_helicase DUF1128 AAA_18 AAA_28 Sigma54_activat AAA_24 IstB_IS21 Mg_chelatase TsaE AAA_25 AAA_33 AAA_7 Zeta_toxin MCM NACHT
Other DBs
NCBI-GeneID: 4332553
NCBI-ProteinID: XP_015632801
UniProt: Q8W422 Q0DSN1
LinkDB
Position
3:10462444..10466193
AA seq 450 aa
MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLP
AVAPLSKCRLRLLKLERVKDYLLMEEEFVVSQERLRPSEDKTEEDRSKVDDLRGTPMSVG
SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPM
VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGT
GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAV
GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRK
IEFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER
RMKVTHADFKKAKEKVMFKKKEGVPEGLYM
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggggcagggcactcccggcgggatggggaagcagggcggcctccccggcgatcgcaag
ccgggcgacggcggcgccggcgacaagaaggaccgcaagttcgagccccccgccgcgccg
tcccgcgtcggccggaagcagcggaagcagaaggggcccgaggcggcggcgcgcctgccc
gccgtggcgccgctctccaagtgccgcctccgcttgctcaagctggagcgggtcaaggac
tacctcctcatggaggaggagttcgtcgtcagccaggagcggctgcgacccagcgaggac
aagacggaggaggaccgatccaaggtcgatgacctccggggcacccccatgagcgttggc
tcgcttgaggagatcatcgatgagagccacgccatcgtctcgtcgtccgtcgggccggaa
tactatgttggcatattatcattcgtcgacaaggaccagctcgagccagggtgtgccatt
ctgatgcataacaaggttctctctgtggttggaattttgcaagatgaggttgaccctatg
gtttctgtcatgaaagttgaaaaggcacctttggagtcttatgcggacatcggtggtctg
gatgcccaaattcaagagattaaagaggctgttgagcttcccttgactcatcctgagcta
tatgaggacattggaataaggcctcccaagggagtaatattatatggggaacctggcaca
ggcaaaactctacttgcaaaggcggttgctaattctacatcagcaacatttttgcgtgtt
gttgggagtgagttgatccaaaagtaccttggtgatggccccaagcttgtaagagaattg
tttagggtggctgatgatctttctccgtcaattgtctttattgacgagattgatgcagtc
ggaacaaagaggtatgatgctcattcgggtggagagcgtgaaattcagagaaccatgttg
gagttgcttaatcagctggatggttttgattcaaggggagatgttaaagttattttagca
acaaatcgcattgaaagtcttgacccagctttgcttcgacctggtcggatagacagaaag
attgaatttccgttaccagatattaaaaccaggaggcggatcttccagatacacacatct
aagatgacattggcagatgatgttaacctagaagagtttgtgatgaccaaggatgagttt
tctggtgctgacatcaaagcaatatgtacggaggccggattgctcgctttaagggagcgc
agaatgaaggtgacacatgccgatttcaagaaggccaaagagaaggtcatgttcaagaag
aaggaaggtgtaccggaagggctttatatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344373
Entry
4344373           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 4 homolog
  KO
K03062  26S proteasome regulatory subunit T2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4344373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4344373
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4344373
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_22 DUF815 AAA_2 AAA_5 AAA_16 RuvB_N ATPase AAA_3 TIP49 RNA_helicase AAA_18 DUF1128 AAA_24 Sigma54_activat AAA_28 AAA_25 IstB_IS21 TsaE Mg_chelatase AAA_33 NACHT Zeta_toxin AAA_7 MCM
Other DBs
NCBI-GeneID: 4344373
NCBI-ProteinID: XP_015647425
UniProt: P46466
LinkDB
Position
7:complement(29435858..29440140)
AA seq 448 aa
MGQGTPGGMGKQGGAPGDRKPGGDGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLPNV
APLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSL
EEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS
VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGK
TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT
KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIE
FPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM
KVTHADFKKAKEKVMFKKKEGVPEGLYM
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggggcagggcaccccgggaggcatgggcaagcagggcggcgcccccggcgaccgcaag
cctggcggcgacggcgacaagaaggaccgcaagttcgagccccccgccgccccctcccgc
gtcggccgcaagcagcgcaagcagaagggccccgaggcggccgctcgcctccccaacgtc
gcccctctctccaagtgccgcctccgcctcctcaagctcgagcgggtcaaggactacctc
ctcatggaggaggagttcgtcgccgcccaggagcgcctccgccccaccgaggacaagacc
gaggaggaccgatccaaggtcgacgacctccgcggcacccccatgagcgtcggatccctc
gaggagatcatcgacgagagccatgccatcgtctcctcctccgtcggccccgagtactac
gtcggcatcctctccttcgtcgacaaggaccagctcgagcccggctgctccatcctcatg
cacaacaaggttctgtctgtggtcggaattttgcaagatgaagttgatcctatggtttct
gtgatgaaagtggagaaagctccgctggaatcctatgctgacattggtgggctagatgct
cagatccaagaaatcaaagaggcagttgagcttcctttgacccatcctgagctatatgaa
gacattggcatcaggccacccaagggagtcatattatacggagaacctggaacagggaag
acactacttgccaaggctgttgctaactccacatccgcaactttcttgcgtgttgttgga
agtgagcttattcaaaagtatcttggtgatggtcccaaactagtcagggaactgttcaga
gttgctgatgagctttctccctcaatagtctttatcgatgagattgatgctgttggaaca
aagaggtacgatgctcattcaggaggggagcgtgagattcagagaactatgttggagctt
cttaaccagttagatggttttgactctcgtggtgatgtcaaagttatactagcaacaaat
cgcatcgaaagtcttgatccagcattgctacgccctggtcgcatagatcggaagatagaa
tttcctctgccagatattaaaactaggcggcgcatcttccagatacacacatctaagatg
acattggcagatgatgtgaacctggaagagtttgtcatgaccaaggatgagttttccggt
gctgatatcaaagcaatatgtactgaagctggacttcttgctttgagagaacgccgaatg
aaggtgacacatgctgacttcaagaaggcaaaggagaaggtgatgttcaagaagaaggaa
ggtgtgccggagggtctttacatgtga

DBGET integrated database retrieval system