KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332557
Entry
4332557           CDS       T01015                                 
Name
(RefSeq) U2 small nuclear ribonucleoprotein B'' isoform X1
  KO
K11094  U2 small nuclear ribonucleoprotein B''
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332557
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332557
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4332557
 Complex B
    4332557
 Complex C
   U2 SnRNP specific factors
    4332557
SSDB
Motif
Pfam: RRM_1 RRM_5 xRRM DUF4523 DUF6428
Other DBs
NCBI-GeneID: 4332557
NCBI-ProteinID: XP_015628121
UniProt: Q10MR0
LinkDB
Position
3:complement(10478308..10482621)
AA seq 232 aa
MLSGDIPPNQTVYLRNLNEKVKKEELKRSLYALCSQYGRILDVVALKTPKLRGQAWVVFS
EITAATNAFRGLQEFDFYGKRMRVQYAKTRSDCLATEDGSTAPKEKRKKQEEKAAEKKRR
AEEAQQSGPNAAAQSNGTGYQASRLGKTSQEPPAPPNNILFIQNLPAETTSMMLQILFQQ
YPGFREVRMIEAKPGIAFVEYEDDSQSMVAMQALQGFKITPYNPMAISYAKK
NT seq 699 nt   +upstreamnt  +downstreamnt
atgttgtccggcgacatacccccgaaccagacggtctacctcaggaacctcaacgagaag
gtcaagaaagaagaattaaagagatcactctatgcgttgtgctcccaatatgggaggata
ctggatgtggtggccttaaaaacacctaaactgagggggcaggcatgggtggtcttcagc
gaaattaccgccgccacaaatgctttccgtggactgcaggaattcgatttttatggcaaa
agaatgcgagtacaatatgcgaaaacaagatctgactgtcttgcaaccgaagatggttct
actgctccaaaagagaaaagaaagaagcaagaggagaaagcagcggagaaaaaacgacga
gctgaagaggcgcaacaatctggtcctaatgctgctgcccaaagcaatgggactggttat
caagcctcacgcctgggcaagacttcgcaagagccacctgcacctccaaacaatatcctt
ttcatccagaacttaccagctgagactacaagcatgatgctccagatcctgttccagcag
taccctggtttcagggaagtccggatgatcgaagccaagccaggcattgcttttgtggaa
tacgaggacgacagccagtctatggttgcaatgcaagctctgcagggtttcaagatcacc
ccatacaacccaatggctatatcctacgcaaagaagtga

DBGET integrated database retrieval system