KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332583
Entry
4332583           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332583
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4332583
   03036 Chromosome and associated proteins [BR:osa03036]
    4332583
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     4332583
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4332583
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4 zf-HC5HC2H_2 zf-Nse
Other DBs
NCBI-GeneID: 4332583
NCBI-ProteinID: XP_015629137
UniProt: B9F7W6 Q0DSK3
LinkDB
Position
3:10672582..10673760
AA seq 84 aa
MKVKILQWHSVASWTWDAQDETCGICRMAFDGCCPDCKFPGDDCPLIWGSCNHAFHLHCI
LKWVNSQTSTPLCPMCRREWQFKG
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtcaagattcttcagtggcattcggtggcttcttggacatgggacgcccaggat
gaaacctgtggtatatgcaggatggcattcgacggctgctgccctgattgtaagttcccc
ggcgacgattgcccgctcatctggggctcctgcaaccacgctttccatctccactgcata
ctcaagtgggtcaattctcaaacatccacaccactttgcccaatgtgccgtagggagtgg
caattcaagggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272104
Entry
9272104           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9272104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    9272104
   03036 Chromosome and associated proteins [BR:osa03036]
    9272104
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     9272104
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    9272104
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4 zf-Nse zf-HC5HC2H_2
Other DBs
NCBI-GeneID: 9272104
NCBI-ProteinID: XP_015645730
UniProt: B9FWS9 Q8H306
LinkDB
Position
7:12882071..12883591
AA seq 84 aa
MKVKILQWHGVASWTWNAQDETCGICRMAFDGCCPDCKFPGDDCPLIWGSCNHAFHLHCI
LKWVNSQTSTPLCPMCRREWQFKG
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtcaagattcttcagtggcatggggtggcttcttggacatggaacgcccaggat
gaaacatgcggcatatgcaggatggcatttgacggctgctgccctgattgtaagttccct
ggcgacgattgtccgctcatctggggttcctgcaaccacgccttccatcttcactgcata
ctcaagtgggtcaattctcagacatctacgccactttgcccaatgtgccgtagggagtgg
caattcaagggctaa

DBGET integrated database retrieval system