KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332589
Entry
4332589           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4332589
  KO
K10728  topoisomerase (DNA) II binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4332589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4332589
   03400 DNA repair and recombination proteins [BR:osa03400]
    4332589
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    4332589
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     4332589
SSDB
Motif
Pfam: BRCT PTCB-BRCT BRCT_2 RTT107_BRCT_5 PHD
Other DBs
NCBI-GeneID: 4332589
NCBI-ProteinID: XP_015627825
UniProt: A0A8J8Y4U4 Q10ML5
LinkDB
Position
3:10752529..10759872
AA seq 1462 aa
MASPISGSDDDDEHLFAGVRFFLVGFDPLSESQYRSEMVRRSGVDAGRFGSGCTHVIVCG
LVYDDPACVAARAEGKKVVTELWVEASLDRGMLADADRVMYWPVRDLNGIAGSESLRICL
TGYQRSDREDIMSMVSLMGAQFSKSLNPDVVTHLICYKFEGEKYEAAKKAKLKFNFNIKL
VNHRWLEDCLKCWKILPVDDYSKSSWELEIMEAQAKDSEDEEDVGQRSFRNKIVRSTLNP
KGSAGTSANPVVNAPIRSPTISSGNIGMVLEKQPNIPGEIRKAEDAVNRIHDVAVQGTPR
TRLAMSANTDFSTPSQIPFIHSDSRGDAAVRDLKNADQIQGNKHKDVGTKTLDVTSGASG
TPCSSKMVVSANHNVHSLNKTNFVEDHGDTDASKADLTTPSREILPANVLDSSNVARGRS
QEDYGATCTPDAAAGQSTINDNVTNNNIGLKSGNNASLNINNKSSLKPLEKSVLPEQYSA
NRIGPLQGADGSMMRSDSSISTARKGDKIIADLAGVQVLKGGENIQDENVLDGAYSQKKK
CSISPVLFKVQNGDTGKETGALNSPSANRLSDTSEPAIWSSVGTNPSEANNVDLGKQQSG
SSKSRSRTALKHGNLVDGIKLPEYSSSETNAQPPPKPKELLATSLSATVHDVKRCPDFSF
QNKDGDYAQDSGNALNQDGSPLMRKTENVLAKVRTSDISLHSSRKSKLVPSSGNGDTEMS
DALDIEKNKAAVASNCKPEKVVPDENIKADQLKDFPGTSNNVLRQTGYLKKVASRKGMKA
STKRPRSASKVVDEPVVDDGKTKTVVSESEPDKMIAHKHIGETAKDGPDSVNAAEHRTNS
SDKVLTDGASRISRRLQNVHTMKNDRHAASNLESSKMISEENTGIGITPKKFVSNATTEG
HQTNSPKMLPNTSMRNTFAKRSRVSDTKMTGESSADKTETVAGKSLFDDLFPSQNIDHPK
KLSSSASADGCGSLSCKNASPARVRNAVAKRKIKALEDKSDSKLGKIGGAIVSAAKAVAS
RGIEESSCNINKVSSDQNSVKTDGMRDVSGLFSSDTSVIDRSENLNNSKLRCSKRNKSLS
LDHEKENMQDNGTLSSKSNGRTAIMNSNLDANSMKHGANMFNEPNRIKGNGPGTLITPEP
TCFILSGHRQQRKDYRSILRCLKARVCRDSHHWSYQATHFIAPDPLKRTEKFFAAAAAGK
WILKTDYLTSCNEVGKLLDEEPFEWSGTGLNDGETISFEAPKKWRVLRQQMGHGAFYGMQ
IIVYGQLVSPSLDTVKRAVRSGDGTILATSPPYTRFLNSGVDFAVVSSAMPSADAWVQQF
ISHDIPCITADYLVEYVCKHGHPLDRHVLFNTNDLANKSLKKLLQNQQEVATDVLKPQED
GDPDDLSCSACGSTDRGEVMLICGNEDGSTGCGVGMHIDCCDPPLEAVPEHDWLCPQCEM
PKATKKSASRVASKSRVSKRKR
NT seq 4389 nt   +upstreamnt  +downstreamnt
atggcctctcccatcagcggcagcgacgacgatgacgagcacctcttcgccggcgtccgc
ttcttcctcgtcgggttcgaccccctctcggagtcccagtatcggtcggagatggtgcgg
cgcagcggcgtggacgccgggaggttcggcagcgggtgcacccacgtcatcgtttgcggc
ctcgtctatgatgacccggcatgcgtggcggcgcgggcggaagggaaaaaggtcgtcacc
gagctttgggtggaagctagcttggatcggggaatgcttgccgatgccgatagggttatg
tattggccggtgcgagatttgaatggaatagcaggcagtgaatcattacgcatttgcttg
acgggctaccaaagaagtgaccgcgaagatataatgagcatggtttctttgatgggagcg
caattctccaaatctttgaatccagacgtagtcactcaccttatttgctataaatttgaa
ggtgagaagtatgaggctgctaaaaaggcgaagttgaagttcaactttaacatcaaactt
gttaatcaccggtggttggaagactgcttaaagtgttggaaaattcttccagtagatgat
tacagcaaaagtagttgggaactagagataatggaggcgcaagccaaggactcagaagat
gaagaagatgtaggccaaagatcatttagaaataagattgtcagatccactctgaaccca
aaaggtagcgcgggaacttctgccaaccctgttgtgaatgcaccaattcggtcaccgact
atttcgagtggtaatatagggatggttttggaaaaacagccgaacattcctggagagatc
aggaaagcagaagatgccgtcaacaggatacatgatgtcgcagtccaaggcactcctaga
actagattggcaatgtctgctaacactgattttagcacacccagtcagattccatttatt
catagtgatagtagaggggatgctgcagtaagagatttgaaaaatgcagatcagatccag
gggaataaacacaaagatgttggcacaaagacacttgatgttacatccggtgcatcaggc
actccatgctcaagcaagatggttgtttctgctaaccataacgtgcattccttaaacaag
acaaattttgtggaggatcatggcgacactgatgctagcaaagctgacttgaccacccca
tccagagaaattctgcctgcaaatgtacttgattcatctaatgttgccagagggcgaagt
caagaggattatggagccacatgtactcctgatgcagcagctggtcagtcaaccattaat
gacaatgtcaccaataataatattggtttgaagtcaggaaacaatgcttcgctcaacatc
aacaacaaaagttctttgaaacccttagagaagtcggtactgcctgaacaatattcagct
aaccgtataggaccacttcagggggctgatgggagcatgatgagatctgattctagtatc
tcgacagcacgtaagggagataaaataattgctgatctagctggcgtccaggttctgaaa
ggtggtgaaaatatacaggatgagaatgtactggatggtgcatattcccaaaaaaagaag
tgctccatttccccagttttgttcaaagtgcaaaatggagatacggggaaagaaactggt
gcgttgaactctccttctgcaaataggcttagtgacacatctgaaccagcaatttggtca
tctgtaggaacaaatccaagtgaagctaataatgttgatttgggaaagcaacagtctggc
tcatctaaatcaagatctaggactgcactcaagcatggtaatctggttgatggaatcaag
ctccctgaatattcttcaagtgagacaaatgcgcagcctccaccgaaaccaaaagaattg
ctcgccacaagcctttcagccactgttcacgatgtaaagagatgtccagatttctctttt
caaaacaaggatggtgattatgcacaagatagtggtaatgcattgaatcaagatggctcg
ccactgatgcgcaagacagaaaacgttcttgcaaaggtcagaacatctgacatatcttta
cacagttcaaggaaatcaaaacttgttccctcttctggaaatggtgatactgagatgtct
gatgcacttgatattgaaaaaaataaggcagcagtggcttcaaattgcaagcctgagaaa
gtggtacctgatgaaaatataaaagcagaccagcttaaagactttccaggtacttcaaac
aatgttctgcgccaaacaggttatttaaagaaagtagcatctcgtaaaggaatgaaagca
agcacaaagagacctcgtagtgctagcaaggtggttgatgagccagtagttgacgatggt
aagactaagacagtggtttctgagtcagagcctgataaaatgattgctcacaagcacatt
ggtgaaacagctaaagatggccctgatagtgtaaacgcagcagaacacagaacaaattct
tcagacaaagttcttacagatggagcgagtaggatttccagaagactgcagaatgttcac
accatgaaaaatgatagacatgcagcttccaacttggaatccagtaagatgatttctgag
gaaaatactggaattgggataacccctaagaagtttgtgagtaatgcaactactgaggga
catcaaacaaattcaccgaaaatgttacccaataccagtatgaggaatacatttgccaag
aggtctcgggtatctgacaccaaaatgactggtgaatcatcagctgataaaactgaaaca
gtggctggcaagtcactatttgatgacttatttccttcccaaaacattgatcaccctaaa
aagctttcaagtagtgcaagtgctgacggctgtggatcactatcctgtaagaatgcatcg
cctgccagagttaggaatgcagttgccaagaggaaaataaaagctctagaagacaagtca
gacagcaagcttggaaaaattggtggtgccattgtatctgcagctaaagctgtggcatca
aggggaattgaagaaagctcatgcaacatcaacaaagtaagttctgatcaaaattctgtg
aagaccgatggaatgagagatgtatctggattattttcgagtgatacttctgtgatagac
aggtcagaaaatctgaataactctaagttgagatgcagcaaaagaaataaatctctttct
ttagaccatgaaaaggagaatatgcaagacaatggtactctcagttctaaatccaatggt
agaactgctattatgaattccaacttagatgcaaattcgatgaagcacggtgcaaatatg
ttcaatgagcccaatagaataaaaggaaacggacctggcaccttgatcacgcctgagcct
acatgttttattttaagtggacatcgccaacagagaaaggactatagatcaatacttcgg
tgcctgaaggcacgagtttgcagggattcacatcattggtcataccaagcgacacatttt
attgccccagaccctctcaagagaactgaaaaattctttgcagctgcagcagctggcaag
tggatactgaaaactgattacttgacctcttgcaatgaggttggcaaattgttggacgaa
gaaccatttgaatggtctggtacaggccttaatgacggggaaacaatcagctttgaagct
cccaagaaatggcgtgttttgaggcagcagatgggccatggtgccttctatgggatgcag
ataattgtatatggacagctcgttagtccatcgctggatacagtaaagcgtgcagtacga
tctggcgatggcaccatcttagcaacctcgccaccgtacacacggttcttgaactctggc
gtcgacttcgctgtggtatcttcggccatgccaagtgcagacgcatgggttcaacaattc
atcagtcacgatattccttgtatcactgctgattatcttgttgagtacgtctgcaagcat
gggcatccgctcgacaggcatgttctcttcaacacaaacgatctggccaacaagtccctc
aagaaactactgcaaaaccagcaagaggtggccacagatgtactgaagccacaggaggac
ggagatcccgacgacctgagctgctcggcgtgcgggagtacggaccggggcgaggtgatg
ctcatctgcggcaacgaggatggctcgaccggctgcggtgtaggtatgcacatcgactgc
tgcgaccctcccctggaagctgtcccagaacatgactggctgtgcccccagtgcgaaatg
cccaaagcgacgaagaaatctgcgtcacgcgtagctagcaaatcgagagtatccaagcga
aaaaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344363
Entry
4344363           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: BRCT domain-containing protein At4g02110
  KO
K10728  topoisomerase (DNA) II binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4344363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4344363
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344363
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    4344363
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     4344363
SSDB
Motif
Pfam: BRCT PTCB-BRCT BRCT_2 RTT107_BRCT_5 BRCT_3 PHD Paired_CXXCH_1
Other DBs
NCBI-GeneID: 4344363
NCBI-ProteinID: XP_015647448
LinkDB
Position
7:complement(29343033..29350932)
AA seq 1393 aa
MPAHGGQDADNRRLFAGVRFALLGFDPVSESQYRSEMVQRGGVDAGAYGAGCTHLIVCDL
LYDNPICVAARKDGTKVVSEQWVDDSLDLGEMADADRVLYRPVRDFSGIPGSQSLRICLT
GYQKNWRDDIMKMASLMGAEFSKSFDALKDTHLICYKFEGEKYKVAKRENTAKRANVSLV
NHQWLEDCLMAWKILPADDYTKSGWEIEIMAAQAKDSEDDEEEAGRSSSHSKRATRSART
KDIRMATLVDPHSQAPTRDPTISSCSAEITAGGHMSTPERITKAGGSTSRSLNIKSDIRN
TPISADSDAYESAHFPLNGKEEAPAAQVHRAEAKDDVKMAVDASPGAHCISNIAGTTVCS
DHHVHQSTTAPAMLVDKTETIGGNCLDSSNQNNVNIALWSTPSKETFSEKTLRPSGISGN
VGQKDGGSTPDLNTAVDQSNTARELTLCEANLRLTGNAASKKNSQVLSYNRRRCRKSVSP
EANLKPTGSPQSFEGVTPRVDFTISPSMKSDHKISDITDAESLRDVEIVKKVNKSSGALA
QKRASKLSSISMKPSVSSETGTANSPFSSRESASEAATFSDPSRNSAESVILTAKEKSGQ
SKSNLLSYRRALKLARPVEGEKLSENSTKSKKSLRENTLALHEVDKGGSSSENGLRSEKG
CAANSSADSEVDKRSSSSSLQNRDTEMSDVPQVDKTEVVAPNTDFAIVVSHQNMEVVPKS
IQVTATISECETFPQEEPTSKVKNASVKRFGNASNKAATRSVKNKDEIVSFKSDGDKVEV
QPEKNHARPNGAECTVFIPEEIPNSKANNAATNNSRDALQMNTALALSKTELAEKNPGSA
SADEYRKSSCEKVSQTADVEMPDAPIVDSTGAMFSKSGFKEVFPPENAGSCPKRLSTNTN
MGGPETCTPSIVPNNRVRKAAAKRKVSAVQQNSFGDVPCKNSSAVVSEFKFVYKRASEGP
RNGSKKTMDQNLQSSNEDGARDAGVSFSEDDMRDRSKILQNSQARSSKRQKAADLMDGST
DHDKENLPGNHNISKSKYGNSCTSLNSFIQAAGSGKDRLADRGVVEENDCGMLTVLEPRL
FILSGHRLLRKEYKLILRRLKGRVCRDSHQWSFQATHFISPELRRTEKFFAAAAAGRWIL
KSDYLTACNEAGKFLEEEPFEWHGNGLNNGDTISLDAPRKWRQLRQHTGHGAFYGMQIII
YGECISPSLDTLKRAVRAGDGTILATSPPYTRFLKKPDHVDFAVVSAGTPSADAWVEEFK
RQGIPCISADYLVEYICKPGQSLNKHVLFNMHDLADKSHAKLLKGQLDDVLGEATXGDAA
EPTCSACGSNDREGGLMLICGSGSDEENGTRMHIPLEAEAEATPGDGGEWLCTSCHKNKF
PHKSAKSRVLKRS
NT seq 4182 nt   +upstreamnt  +downstreamnt
atgcccgcacacggcggccaagatgccgacaaccggcgcctcttcgccggcgtccgcttc
gcgctccttggcttcgaccccgtctccgagtcccagtatcgctccgagatggtgcagcgc
ggcggcgtggacgccggggcctacggcgcaggctgcacccacctcatcgtctgcgacctc
ctatacgataacccaatctgcgtggcggcgcgcaaggacggcaccaaggtcgtatccgag
caatgggtggacgatagcttggatctcggagagatggctgatgctgatcgggtactatat
agaccagtgagagatttcagcggcataccgggtagtcaatcactacgcatttgcttgaca
gggtaccaaaagaattggcgtgacgatattatgaaaatggcttctttgatgggagcagag
ttctccaagagttttgatgcgctcaaagacacccatctcatttgctataaatttgaaggt
gagaagtacaaagttgcaaaacgggaaaataccgccaaacgggcaaatgtcagtctggtt
aatcatcagtggctggaagattgcttaatggcatggaaaattcttccagctgatgattat
acgaaaagcggttgggaaatagagataatggcagcacaagccaaggactccgaagatgat
gaagaagaagctggtagaagctcatctcatagtaaacgtgcaactagaagcgcacgcact
aaagatattagaatggctactcttgttgatcctcatagtcaagcacccactagagatcct
actatctcctcttgcagtgcagaaattactgctggaggacacatgagcactccagagcgg
attacgaaagcaggaggttcaaccagtagatcactcaacattaaatcagacatacggaat
actccaatatctgctgattctgatgcttatgaatctgcccattttcctcttaatggcaag
gaagaggctcctgcagctcaggtccacagagctgaagccaaagatgatgttaaaatggca
gttgatgctagtcctggtgcacattgtatttccaacatagctgggaccacagtttgttct
gatcatcatgtgcatcaatcaactactgcacctgctatgttggtggacaaaacagagacc
attggtggaaattgtttggatagcagtaatcagaacaatgtgaacattgcactttggtca
accccttccaaagaaactttctcagagaaaacattacggccatcaggtataagtggaaat
gtaggccagaaggatggtggatctacacctgatcttaatactgcagttgatcagtcaaat
actgcacgggagctaactttgtgtgaggctaatttgagattaacaggcaatgcagcatca
aagaagaatagccaagtcttaagttacaacagaagacgttgccggaagtctgtgtcacca
gaagctaatttaaaaccaacaggatcaccacaaagttttgagggagttaccccaagggtt
gactttactatctctccatcaatgaaaagtgatcacaaaattagtgacattactgatgct
gaaagcctgagagacgttgagatagtaaagaaggtgaataaatcaagtggtgcactcgct
cagaagagggcaagtaagctttcttcaatcagtatgaagccatccgtaagctcagaaact
ggaactgcaaatagtcctttctcaagcagggaaagtgcatctgaagcagcaacgttttct
gatcccagtagaaactctgctgaatctgtgattttaactgcaaaagaaaagtctggccaa
tctaaaagcaacctgttgagctataggagggccttgaaacttgcaaggcctgttgaagga
gaaaagctttctgaaaactctactaagagtaagaaatcactgagagaaaatacacttgca
ctgcatgaggttgacaaaggaggttctagttctgaaaatggtctaaggtctgaaaaaggt
tgtgctgcaaactcatctgccgattctgaagttgacaaaagaagttctagttcatctctt
caaaacagggacactgagatgagtgatgtgcctcaggttgacaaaactgaagttgtagct
cctaacacggattttgcaattgtggtttctcatcaaaacatggaagtggttcctaaatcg
atccaagttactgcaaccatcagtgaatgcgaaacatttccccaggaagaacctacttct
aaagtgaagaatgccagtgtcaagaggtttgggaatgcctcaaataaagcagccactaga
tctgtaaagaacaaagatgagattgtatctttcaagtctgatggtgataaagttgaggtg
caaccagaaaagaatcatgctagaccaaatggtgctgaatgtacagtattcattcctgaa
gaaatcccaaatagtaaagcaaataatgcagctaccaacaactcgcgggatgctttacag
atgaacacagcactagcactttccaagactgagttagcagagaaaaatcctggcagtgca
agtgctgatgaatatcgaaagagttcatgtgagaaggtatctcaaacagctgatgtcgag
atgcctgatgctccaattgttgatagcactggagccatgttttcaaagtcaggttttaag
gaagtgtttcctccagaaaatgcaggatcttgccctaagagactctcaaccaacacaaat
atgggtggccctgaaacatgcacccccagtattgtaccaaacaacagagtacgaaaggca
gcagccaagaggaaagtatctgctgtccagcaaaacagctttggtgatgtgccttgcaag
aacagcagtgctgttgtgtctgaatttaaatttgtgtataagagagcttcagagggtcct
agaaatggtagcaagaaaacaatggatcagaatcttcagagttccaatgaggatggggcc
agagatgccggtgtatcattttctgaagatgacatgcgagatagatcgaaaatattgcaa
aattcgcaagcaagaagcagcaaaagacaaaaggcagcagatttaatggatggttctact
gatcatgacaaggagaacctaccagggaatcataatatttccaaatcaaaatatggaaac
agttgtacgagtctgaacagttttattcaagctgcaggaagtggcaaagacaggcttgct
gaccgcggtgtggtagaagaaaacgattgtggaatgttaactgtgctggagcccagatta
tttattttgagtgggcatcgccttctgagaaaggagtataagttgatacttagacgcctg
aagggaagagtttgtagggattcgcatcaatggtctttccaagcaactcattttatctcc
cctgagctccgcagaactgaaaaattctttgcggcagctgccgctggcaggtggatacta
aagtctgattatttgactgcttgtaatgaggctgggaagttcttagaggaagaaccattt
gagtggcatggtaatggccttaacaatggtgatactataagtttggatgctcctcggaaa
tggcgccaactaaggcagcatactggccatggcgctttctacgggatgcagataattata
tacggggagtgcatttctccatcactggatacactgaagcgcgcggtgagagctggcgat
ggcaccatcttggcaacctccccaccttacacccggttcttgaagaaacctgatcacgtc
gacttcgctgttgtatctgctgggacgccaagcgcagatgcatgggtagaggagtttaag
aggcagggcattccatgcatcagcgcagattatcttgtggagtacatctgcaagccaggt
cagtccctaaacaagcatgtcctcttcaacatgcacgatctggcagacaagtcccatgcg
aagctactcaagggccagcttgacgacgtgcttggagaggcaactngaggcgatgcagct
gaaccaacttgttcggcttgtggatccaacgaccgggaaggaggactgatgctgatctgt
ggcagtggcagtgacgaggagaatggaacccggatgcatattccccttgaagctgaagct
gaagctaccccaggtgatggaggagagtggctgtgcaccagctgccacaaaaataaattc
ccccacaagtctgccaaatcaagagtgctgaaacgtagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349978
Entry
4349978           CDS       T01015                                 
Name
(RefSeq) DNA topoisomerase 2-binding protein 1-A isoform X1
  KO
K10728  topoisomerase (DNA) II binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4349978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4349978
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349978
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    4349978
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     4349978
SSDB
Motif
Pfam: PTCB-BRCT BRCT BRCT_2 LIG3_BRCT RTT107_BRCT_5 BRCT_3
Other DBs
NCBI-GeneID: 4349978
NCBI-ProteinID: XP_015616980
LinkDB
Position
11:4614155..4623390
AA seq 979 aa
MTPSHGAAAAAASSSAGAGRRAATFAGASVFLSRSLVAPEVYDAVHDALRLNGAEVFLCA
DPARTGPLDFHVISSSSHERFADLRAKGCNLLGPQCILSCAKEHRFLPKQGYTCCLAMDG
VKILCSGFEKDEKAKIEQLVTAMGGTLQNKAYTDANFVIAKDVLAAKYKWAVNTLKKPIV
SRNWLEQCWIEHRVVPHEPYRIPPFSGLNICITKLNVDERRELAKIIVQNGGQYSANLTR
RCTHLVSNEPGGDKYVVAQKWGNIHIVVPKWIDQSVARKVCLDESAYLVCQNSTNINGVK
HSLKEQHNPEISSASFQPVPTTSVDDSVSTSQYVPASFDDASKICSTDIGAPSFQETKEL
QVDSHVAEDSEAEDDDLYLSNCRISLVGFEEKESSRLVMMIRNGGGSRHVMLSERLTHII
LGAPSEEEKKEVRRLAAWGVINVVKATWLEDCNKAKKEVKVSPSYVANELLAKEFSCAVM
EKTVMRETKAAKNSGGIFHIPTVNDLHDKQLGNDLSSERKSARGKHETMNSNRTATKSAI
SSQQNGVASTSEYHPKFQVNSSAINRQSSRSSNTFKGRIFCFSNSFSHDRRAQVVDWVRE
GGGIMVDDAQSTVVDFIIESHGQNSMLRDSSHSTAVSTHWIRSCLEEGCFQDVGSHPIFS
PLCCRIPFPGFEDFRFCVSQYEEKDRLLLKNLCFILGSKFTEKATKKVTHLICKFASGPK
YEAYYSRGIPTITAEWLFECVRQDRIVPFDQFQPKPPTSQDRDAGLCTVSQYPTQAAKTI
SRFDCSESHTESQLPRSSSKYNSAGNASVNEEPNDPGVSKRRRLSEFGKANDTSGNIGRT
EELQDSTPVPDVADAIEDLLVQSSKIQDVQPPRSIFAPDDSVLNQDQENTHSFGISRHWL
NMPQKLHSTPDTKVQSGNSATTSAAPPAAATAYYPFSETQTESQVVGYEEDLTGRQKIID
RVRSQSINVTPAAEMSSDT
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgacgccgtcgcacggcgccgcggctgcggcggcgtcgtcctccgccggcgccgggcgg
agggccgcgacattcgcgggggcgagcgtgttcctgtcgcggagcctggtggcacccgag
gtgtacgacgccgtgcacgacgcgctccgcctcaacggcgccgaggtcttcctctgcgcc
gaccccgcccggacggggccgctcgacttccacgtcatctcctcctcctcccacgagagg
ttcgcggatctgagagccaaaggctgcaatttactcggaccacagtgcattctttcctgt
gcgaaggaacaccgcttcctacctaagcaaggttatacttgttgtcttgcaatggatggg
gttaagatactttgctcaggttttgaaaaagatgagaaggcaaagattgaacaattagtg
acagctatgggaggtactttacaaaacaaagcatacacggatgctaactttgtaattgca
aaggatgtattggctgccaaatacaaatgggctgtgaatactctgaagaagcctattgtc
agcaggaactggttagagcaatgttggattgaacatcgtgttgtacctcatgaaccttac
agaatccctcctttttctgggttgaatatttgcatcaccaaactgaatgtagacgaacgg
agggagttggcaaaaataatagtgcagaatggtggccagtattcagcaaatcttacacgg
cggtgcactcatttagtttcaaatgaacctggaggtgacaagtatgttgtggcccaaaaa
tggggtaatatccacatagtagttcccaaatggatcgaccaatctgttgctcgaaaagtt
tgccttgatgaaagtgcataccttgtttgtcagaattccactaatattaatggtgtaaaa
cattcccttaaggaacaacacaaccctgagatcagtagtgcaagttttcaacctgttcca
acaacatctgtagatgactcagtatcaacgtcacagtatgtgcctgcttcatttgatgac
gcttcaaagatctgcagtactgatattggcgcacctagtttccaagagacaaaagaacta
caggttgatagccatgttgctgaggactcagaggcagaagatgatgacctttatttatca
aattgtagaatttctctggtgggttttgaggagaaagagtcgtcaaggttagtcatgatg
atacgcaatggtggtggatcccggcatgttatgttaagtgagagactcacacatattatt
cttggtgcaccatcagaggaagaaaaaaaggaggtgagacgtctggctgcttggggtgta
atcaatgtggtaaaagcaacatggttagaagactgcaacaaagcaaaaaaggaggtgaaa
gtatccccaagttatgtggctaatgagttgctcgcgaaagagttttcatgtgcggttatg
gaaaaaactgttatgcgggaaacaaaagcagccaaaaactcaggtggaatttttcatatt
ccaaccgtcaatgacttgcatgataaacaacttggaaacgatctgtcatctgaaagaaaa
tcagcacggggcaaacatgaaaccatgaatagtaaccggacagcaacgaagtctgcaata
tcaagtcaacagaatggagtggctagtactagcgagtaccaccccaaatttcaagtaaac
tcttctgcaataaatcggcagagtagcagatcatcaaatactttcaaagggagaatattt
tgtttctcaaattcattttcccacgatcggagagctcaggttgttgactgggtcagagaa
ggtggaggcattatggtggatgatgcacaatcaacagttgtggatttcattatcgagagc
cacggacagaatagcatgctccgcgactcttctcattcaactgctgtttccactcattgg
atacgctcatgtttggaggagggctgcttccaagatgtgggaagccatcctattttctca
cctttgtgctgtcgcatcccgtttcctgggtttgaagattttcgtttctgtgtgtcacaa
tatgaagagaaagatagacttctgctgaagaacttgtgctttatcctcggaagtaaattt
acagagaaagcaacaaagaaagtgacccatcttatctgcaaatttgcaagtggtccaaag
tatgaggcttactatagtaggggaattccaaccataacagcagagtggctctttgagtgt
gtaagacaggatagaattgtcccttttgaccagtttcagccaaaaccacctacttctcag
gacagagatgctggtctatgcactgttagtcaatatcccacacaggccgcaaagacaatt
tccagatttgactgctctgagtcgcatactgaatctcaattaccaagaagcagttcaaaa
tacaactccgcaggtaatgcctctgttaatgaggaaccaaatgatcctggtgttagtaaa
aggaggcgattatccgagtttggcaaagctaatgatacatctggaaacataggaagaact
gaggaactccaggatagtacccctgttcctgatgttgcagatgcaatagaggacctactg
gttcaatcatccaagattcaggacgtacaacctcctaggagtatttttgcacccgatgat
tctgttcttaatcaagatcaggaaaatacacactcttttggcatttcaaggcactggttg
aacatgccacagaagctacacagcacccctgacacgaaagttcaaagtgggaactcagcc
accacctctgctgcccctcctgccgcagccactgcctattatcctttcagtgaaactcag
actgagtctcaggtcgttggctatgaagaagatttgactggcaggcaaaagattatcgac
agagttcgttctcagagcattaatgtcaccccggcagctgaaatgtcttccgatacttag

DBGET integrated database retrieval system