KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332592
Entry
4332592           CDS       T01015                                 
Name
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal
  KO
K01913  acetate/butyrate---CoA ligase [EC:6.2.1.1 6.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332592
   00620 Pyruvate metabolism
    4332592
   00630 Glyoxylate and dicarboxylate metabolism
    4332592
   00650 Butanoate metabolism
    4332592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4332592
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     4332592
    6.2.1.2  medium-chain acyl-CoA ligase
     4332592
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   4332592
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4332592
NCBI-ProteinID: XP_015632927
UniProt: B7FA23 A0A8J8XS63
LinkDB
Position
3:complement(10816017..10820580)
AA seq 567 aa
MAAERDIDDLPRGGANYTALTPLWFLERAALAHPARASVVHGPVRYTWADTYRRCRRLAS
ALERRSVGHGSTVAVIAPNIPAVYEAHFGVPMAGAVVNCVNIRLNAPTVAFLLEHSSAEV
VMVDQEFFSLAEDSLRIIAEQKKGAFKQPLLIVIGDQTCDPVSLKSALSKGAIEYEEFLE
TGDPEFAWKPPQDEWKSIALGYTSGTTSNPKGVVLHHRGAYLMSLSGALVWGMNEGAVYL
WTLPMFHCNGWCYTWTLAALCGTSICLRQVTAKAIFSAIANQGVTHFCGAPVVLNTIVNA
PPADAILPLPRVVNVMTAGAAPPPSVLASMSKLGFRITHTYGLSETYGPSTVCAWKPEWD
ELPDDERARLHARQGIRYVGLEGLDVVDPKTMAPVPADGSTLGEIVMRGNGVMKGYLKNP
RANAEAFENGWFHSGDLGVKHTDGYIEVKDRAKDIIISGGENISSLEVEKAVYQHPAVLE
ASVVARADEQWGESPCAFVTPKDGADSSDEAALAGDIMRFCRERLPGYWVPKSVVFGPLP
KTATGKIKKHELRAKAKELGPVRKSRM
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcggcggagagggacatcgacgacctgccgcgggggggcgccaactacacggcgctc
acgccgctctggttcctggagcgcgccgcgctggcgcacccggcgcgggcatccgtcgtg
cacggccccgtgcgctacacctgggccgacacctaccgccgatgccgccgcctcgcctcc
gccctcgagcgccggtccgtcggccacgggagcacggtagctgtaatagctccaaatatc
ccagcagtatatgaggcccattttggagttccaatggctggagcagtggtgaactgcgtc
aacattcgattaaatgctcctactgttgcatttctcttggagcactcatcagcggaagtt
gtgatggttgaccaggaatttttctccctagcagaggattctctgaggattattgcggag
caaaagaaaggagctttcaaacagccacttctaattgttattggtgatcaaacttgtgat
cccgtgtccctcaaaagtgctttgagtaaaggagccattgagtatgaggagtttctggaa
actggcgatcctgaatttgcctggaaaccaccacaggatgaatggaagagtattgcctta
ggttatacttccgggacaacttccaacccaaagggcgtggtactgcatcacaggggtgct
tacctaatgtcactgagtggtgctctggtatggggaatgaatgaaggcgctgtttatttg
tggactttgccgatgttccactgtaatggctggtgctatacatggacacttgctgctctt
tgtggaacaagcatttgtcttcgtcaggttacagcaaaggccatcttctcggcgatagcc
aaccaaggcgtgacccacttctgtggtgcaccggttgtcctcaacaccatcgtcaacgct
ccgccggctgacgccatcctccccctgccgcgtgtcgtcaacgtcatgaccgccggcgcc
gcgccgccgccgtcggtgctcgcgtccatgtcgaagctcggtttccgcatcacccacacc
tacgggctgtccgagacgtacggcccgtccacggtgtgcgcgtggaagccggagtgggac
gagctgccggacgacgagcgcgcccgcctccacgcccgccagggcatccgctacgtgggc
ctcgagggcctcgacgtcgtcgacccgaagacgatggcgcccgtccccgccgacggctcg
acgctcggggagatcgtcatgcgcgggaacggcgtcatgaaggggtacctcaagaacccc
agggcgaacgcggaggcgttcgagaacgggtggttccactccggcgacctcggcgtgaag
cacaccgacgggtacatcgaggtgaaggacagggctaaggacatcatcatctccggcggg
gagaacatcagcagcctggaggtggagaaggcggtgtaccagcacccggcggtgctggag
gcgtcggtggtggcgcgggccgacgagcagtggggggagtcgccatgcgcgttcgtgacg
cccaaggacggcgccgacagctccgacgaggcggcactcgccggcgacatcatgcggttc
tgccgggagaggctgccggggtactgggtgcccaagtccgtcgtgttcgggccgctgccc
aagacggcgacggggaagatcaagaagcacgagctgagggccaaggccaaggaattgggc
ccggtccggaagagcaggatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332593
Entry
4332593           CDS       T01015                                 
Name
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal
  KO
K01913  acetate/butyrate---CoA ligase [EC:6.2.1.1 6.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332593
   00620 Pyruvate metabolism
    4332593
   00630 Glyoxylate and dicarboxylate metabolism
    4332593
   00650 Butanoate metabolism
    4332593
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4332593
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     4332593
    6.2.1.2  medium-chain acyl-CoA ligase
     4332593
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   4332593
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4332593
NCBI-ProteinID: XP_015631446
UniProt: Q10MK9 Q0DSJ4
LinkDB
Position
3:complement(10824155..10827486)
AA seq 574 aa
MGSPGHGDAAERDIDDLPRNDANYTALTPLWFLERAAVVHPDRAAVVHGPVRYTWAETYR
RCRRLASALAQRSVGPGCTVAVIAPNVPALYEAHFGVPMSGAVVNCVNIRLNAETIAFLL
DHSVAEVVMVDQEFFTLAEESLKILAEKKKWSFRPPILIVIGDPTCDPKPLQYALGRGAI
EYEEFLKTGDPEFAWKPPKDEWQSIALGYTSGTTSSPKGVVLHHRGAYVMALGVAMVWGM
PEGAVYLWTLPMFHCNGWCYTWAMAAMCGTNICLRQVSSKAIYSGIVNHGVTHMCAAPVV
FNNLINAPASETFLPLPRVVNIMVAGAAPTPSLLAALSIRGFRVTHTYGLSETYGPSTVC
AWKPEWDRLPLEERSRLHCRQGVRYGALEGLDVVDPKTMAPVAADGKSYGEIVMRGNAVM
KGYLKNPKANAEAFAGGWYHSGDLGVKHPDGYIEVKDRMKDIIISGGENISSLEVEKVLY
AHPAVLEASVVARADEQWGESPCAFVTLKEGADSSDEAAVAGDIMRFCRERMPGYWVPKS
VVFGPLPKTATGKIKKHELRTKAKELGPVKKSRM
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgggctcgccggggcatggggatgcggcggagagggacatcgacgatctcccacggaac
gacgccaactacacggcgctgacgccgctctggttcctggagcgcgccgccgtggtccac
ccggacagggccgccgtcgtgcacggcccggtgaggtacacctgggcggagacctaccgc
cgctgccgccgcctcgcctccgccctcgcgcagcgatccgtcggccccggctgcacggtc
gctgtgattgctccaaatgtcccggcactgtatgaagctcatttcggcgtccccatgtct
ggagcggtggtgaactgcgtaaacatcaggttaaacgccgagacaattgccttcctcctt
gaccactcagtggcagaggtcgtcatggtggaccaggaattcttcaccctagctgaagag
tccctgaagatactggccgagaagaagaaatggtcgttcaggcccccgatcctgatcgtc
atcggcgacccgacctgcgatccgaagcctctgcagtacgctctggggagaggagcgatc
gagtacgaggagttcctgaagaccggtgacccggagttcgcctggaagccgcccaaggat
gaatggcagagcatcgcgttgggttacacctccgggactacttcgagccccaagggcgtc
gtgctgcaccaccgtggcgcctatgtcatggcgctcggtgtcgccatggtttgggggatg
cctgagggagctgtgtacctgtggactctgcccatgttccattgtaatggttggtgttac
acttgggcaatggctgcgatgtgtggaaccaacatatgtcttcgccaggtgagttcaaag
gcgatatactctggcatagtgaaccatggagtgacacacatgtgcgccgcgccggtcgtc
ttcaacaacctcatcaacgctccggcgagcgagaccttcctgccgctcccgcgcgtggtc
aacatcatggtggccggagccgccccgacgccgtcgctgctcgcggcgctgtcgatccgc
ggcttccgcgtgacccacacgtacgggctgtcggagacgtacggcccgtcgacggtgtgc
gcgtggaagccggagtgggacaggctgccgctggaggagcggtcgcggctgcactgccgg
cagggcgtgaggtacggggcgctggagggcctcgacgtggtggacccgaagacgatggcg
ccggtggccgccgacggaaagtcgtacggggagatcgtgatgcggggcaacgccgtgatg
aagggctacctgaagaaccccaaggcgaacgcggaggcgttcgccggcgggtggtaccac
tccggcgaccttggggtgaagcaccccgacgggtacatcgaggtgaaggaccggatgaag
gacatcatcatctccggcggggagaacatcagcagcctggaggtggagaaggtgctgtac
gcgcacccggcggtgctggaggcgtcggtggtggcgagggcggacgagcagtggggggag
tcgccgtgcgcgttcgtgacgctcaaggaaggcgccgacagctccgacgaggcggcggtg
gccggcgacatcatgcggttctgcagggagaggatgccggggtactgggtgcccaagtcg
gtggtgttcgggccgctgcccaagacggcgacggggaagatcaagaagcacgagctgagg
accaaggccaaggagctcggccccgtcaagaagagcaggatgtga

DBGET integrated database retrieval system