KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332607
Entry
4332607           CDS       T01015                                 
Name
(RefSeq) nicotianamine synthase 2
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332607
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4332607
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     4332607
SSDB
Motif
Pfam: NAS Methyltransf_25 PAS_8
Other DBs
NCBI-GeneID: 4332607
NCBI-ProteinID: XP_015630628
UniProt: Q10MI9
LinkDB
Position
3:10926452..10927926
AA seq 326 aa
MEAQNQEVAALVEKIAGLHAAISKLPSLSPSAEVDALFTDLVTACVPASPVDVAKLGPEA
QAMREELIRLCSAAEGHLEAHYADMLAAFDNPLDHLARFPYYGNYVNLSKLEYDLLVRYV
PGIAPTRVAFVGSGPLPFSSLVLAAHHLPDAVFDNYDRCGAANERARRLFRGADEGLGAR
MAFHTADVATLTGELGAYDVVFLAALVGMAAEEKAGVIAHLGAHMADGAALVVRSAHGAR
GFLYPIVDLEDIRRGGFDVLAVYHPDDEVINSVIVARKADPRRGGGLAGARGAVPVVSPP
CKCCKMEAAAGAFQKAEEFAAKRLSV
NT seq 981 nt   +upstreamnt  +downstreamnt
atggaggctcagaaccaagaggtcgctgccctggtcgagaagatcgccggcctccacgcc
gccatctccaagctgccgtcgctgagcccatccgccgaggtggacgcgctcttcaccgac
ctcgtcacggcgtgcgtcccggcgagccccgtcgacgtggccaagctcggcccggaggcg
caggcgatgcgggaggagctcatccgcctctgctccgccgccgagggccacctcgaggcg
cactacgccgacatgctcgccgccttcgacaacccgctcgaccacctcgcccgcttcccg
tactacggcaactacgtcaacctgagcaagctggagtacgacctcctcgtccgctacgtc
cccggcattgcccccacccgcgtcgccttcgtcgggtcgggcccgctgccgttcagctcc
ctcgtgctcgccgcgcaccacctgccggacgcggtgttcgacaactacgaccggtgcggc
gcggccaacgagcgggcgaggaggctgttccgcggcgccgacgagggcctcggcgcgcgc
atggcgttccacaccgccgacgtggcgaccctgacgggggagctcggcgcgtacgacgtc
gtgttcctggcggcgctcgtgggcatggcggccgaggagaaggccggggtgatcgcgcac
ctgggcgcgcacatggcggacggcgcggcgctcgtcgtgcggagcgcgcacggggcgcgc
gggttcctgtacccgatcgtcgatctcgaggacatccggcggggcgggttcgacgtgctg
gccgtgtaccaccccgacgacgaggtgatcaactccgtcatcgtcgctcgcaaggccgac
ccgcgtcgcggcggcgggctcgccggcgcacgcggcgcggttccagtggtgagcccgccg
tgcaagtgctgcaagatggaggcggccgccggcgcgttccagaaggcggaagagttcgcc
gccaagaggctatccgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332608
Entry
4332608           CDS       T01015                                 
Name
(RefSeq) nicotianamine synthase 1
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332608
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4332608
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     4332608
SSDB
Motif
Pfam: NAS Methyltransf_25 PAS_8
Other DBs
NCBI-GeneID: 4332608
NCBI-ProteinID: XP_015630629
UniProt: Q0DSH9 H9BE58
LinkDB
Position
3:complement(10929503..10930911)
AA seq 332 aa
MEAQNQEVAALVEKIAGLHAAISKLPSLSPSAEVDALFTDLVTACVPASPVDVAKLGPEA
QAMREELIRLCSAAEGHLEAHYADMLAAFDNPLDHLARFPYYGNYVNLSKLEYDLLVRYV
PGIAPTRVAFVGSGPLPFSSLVLAAHHLPDAVFDNYDRCGAANERARRLFRGADEGLGAR
MAFHTADVATLTGELGAYDVVFLAALVGMAAEEKAGVIAHLGAHMADGAALVVRSAHGAR
GFLYPIVDPEDVRRGGFDVLAVCHPEDEVINSVIVARKVGAAAAAAAARRDELADSRGVV
LPVVGPPSTCCKVEASAVEKAEEFAANKELSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggaggctcagaaccaagaggtcgctgccctggtcgagaagatcgccggcctccacgcc
gccatctccaagctgccgtcgctgagcccatccgccgaggtggacgcgctcttcaccgac
ctcgtcacggcgtgcgtcccggcgagccccgtcgacgtggccaagctcggcccggaggcg
caggcgatgcgggaggagctcatccgcctctgctccgccgccgagggccacctcgaggcg
cactacgccgacatgctcgccgccttcgacaacccgctcgaccacctcgcccgcttcccg
tactacggcaactacgtcaacctgagcaagctggagtacgacctcctcgtccgctacgtc
cccggcattgcccccacccgcgtcgccttcgtcgggtcgggcccgctgccgttcagctcc
ctcgtgctcgccgcgcaccacctgccggacgcggtgttcgacaactacgaccggtgcggc
gcggccaacgagcgggcgaggaggctgttccgcggcgccgacgagggcctcggcgcgcgc
atggcgttccacaccgccgacgtggcgaccctgacgggggagctcggcgcgtacgacgtc
gtgttcctggcggcgctcgtgggcatggcggccgaggagaaggccggggtgatcgcgcac
ctgggcgcgcacatggcggacggcgcggcgctcgtcgtgcggagcgcgcacggggcgcgc
gggttcctgtacccgatcgtcgatcccgaggacgtcaggcgtggcgggttcgacgttctg
gcggtgtgccacccggaggacgaggtgatcaactccgtcatcgtcgcccgcaaggtcggt
gccgccgccgccgccgccgcggcgcgcagagacgagctcgcggactcgcgcggcgtggtt
ctgccggtggtcgggccgccgtccacgtgctgcaaggtggaggcgagcgcggttgagaag
gcagaagagtttgccgccaacaaggagctgtccgtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344361
Entry
4344361           CDS       T01015                                 
Name
(RefSeq) nicotianamine synthase 3
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4344361
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4344361
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     4344361
SSDB
Motif
Pfam: NAS Methyltransf_25 Methyltransf_24
Other DBs
NCBI-GeneID: 4344361
NCBI-ProteinID: XP_015645101
UniProt: Q0D3F2 H9BE60
LinkDB
Position
7:29323078..29324696
AA seq 343 aa
MTVEVEAVTMAKEEQPEEEEVIEKLVEKITGLAAAIGKLPSLSPSPEVNALFTELVMTCI
PPSSVDVEQLGAEAQDMRGRLIRLCADAEGHLEAHYSDVLAAHDNPLDHLALFPYFNNYI
QLAQLEYALLARHLPAAPPPSRLAFLGSGPLPLSSLVLAARHLPAASFHNYDICADANRR
ASRLVRADRDLSARMAFHTSDVAHVTTDLAAYDVVFLAALVGMAAEEKARMVEHLGKHMA
PGAALVVRSAHGARGFLYPVVDPEEIRRGGFDVLAVHHPEGEVINSVIIARKPPVAAPAL
EGGDAHAHGHGAVVSRPCQRCEMEARAHQKMEDMSAMEKLPSS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgacggtggaagtggaggcggtgaccatggcgaaggaggagcagccggaggaggaggag
gtgatcgagaagttggttgagaagatcaccgggctggcggcggccatcggcaagctgccg
tcgctgagcccgtcgccggaggtgaacgcgctgttcacggagctggtgatgacctgcatc
ccgcccagcagcgtggacgtggagcagctgggggcggaggcgcaggacatgcgcggccgc
ctcatccgcctctgcgccgacgccgagggccacctcgaggcgcactactccgacgtcctc
gccgcccacgacaacccgctcgaccacctcgccctcttcccctacttcaacaactacatc
cagctcgcccagctcgagtacgccctcctcgcccgccacctccccgccgccccgccgccc
tcccgcctcgccttcctcggctccggcccgctcccgctcagctccctcgtcctcgccgcc
cgccacctccccgccgcctccttccacaactacgacatctgcgccgacgccaaccgccgc
gccagccgcctcgtccgcgccgaccgcgacctgtccgcgcgcatggccttccacacctcc
gacgtcgcccacgtcaccaccgacctcgccgcctacgacgtcgtgttcctggcggcgctg
gtgggtatggccgccgaggagaaggcgcgcatggtggagcacctcgggaagcacatggcg
cccggcgccgccctggtggtgcggagcgcgcacggcgcccggggattcctgtaccccgtg
gtggacccggaggagatccgccgcggcggcttcgacgtgctcgccgtgcaccacccggag
ggcgaggtgatcaactccgtcatcatcgcgcgcaagccgcccgtggcggcgccggcgttg
gagggaggagacgcgcacgcgcacggccatggcgccgtggtgagccgtccatgccagcgc
tgcgagatggaggcgagggcgcaccagaagatggaggacatgtccgccatggagaagctg
ccctcctcgtag

DBGET integrated database retrieval system