KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332642
Entry
4332642           CDS       T01015                                 
Name
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332642
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332642
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     4332642
SSDB
Motif
Pfam: ASL_C Lyase_1
Other DBs
NCBI-GeneID: 4332642
NCBI-ProteinID: XP_015632750
UniProt: Q10MD1 Q0DSE5
LinkDB
Position
3:11210772..11214948
AA seq 543 aa
MSAPPLLKAPAAAAASLVAAAAAHRATAAAAAPSGASRVPPRRLRCSASGAAAVEVRAPM
DWATRSLEEMQRAEDFDSFCLMGLSPLDGRYERFTRDLKPFFSEFGLIRYRVIVEVKWLL
KLSQIPEINEVPPFSKEAQLFLDAIIQDFSVADAKEVKKIEKTTNHDVKAVEYFLKQKCS
SNPEIAKVLEFFHFGCTSEDINNLSHALALKEGVNTVMFPVMMDICKAMCSLATQNSTIP
MLSRTHGQPASPTTLGKEMANFAARLSSIGNSFSEVKILGKFAGAVGNYNADVVAYPEVD
WPKVAEDFVKSLGLEFNPYVTQIEPHDYISKLFNLFVQFNNVLTDFDRDMWTYISLGYFK
QIVKAGEVGSSTMPHKVNPIDFENSDGNLTIANGTLSSLSMKLPISRMQRDLTDSTVLRN
LGVGLGHSLLAYKATLRGINKVQVNESRLSEDLDQTWEVLAEPIQTVMRRYGIPEPYEKL
KEMTRGQAVTKDSIRQFIEDLDLPEAARSSLLKLTPHSYIGEAEFLARNIEEVVDLKSGF
KIE
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgtcggcgccgccgttgctgaaggctccggccgccgccgccgcctccctcgtcgcggcg
gccgcggcccaccgcgctacggccgccgccgccgccccgtccggtgcgtcccgcgtcccg
ccgcgacgcttgcgctgctctgcatcaggcgccgccgccgtcgaggtgcgtgctccgatg
gattgggcgacgaggtcgctggaggagatgcagcgggcagaggacttcgactctttctgc
ctgatggggctttcgccgctggatgggcggtacgagcgctttaccagggacctgaaaccc
ttcttcagtgagttcggcctcatcagataccgggtcatcgttgaggtaaagtggctactg
aaactctcccaaatccctgagatcaatgaggtgcctccattcagcaaggaggcccagtta
ttcctggatgcgattatccaggatttcagtgttgctgatgcaaaagaagtgaaaaagatt
gagaaaacaaccaaccatgatgtgaaggctgttgagtactttctcaagcaaaaatgcagc
tcaaatccagagattgcaaaggtgttggagttcttccattttggatgtacttctgaagat
atcaacaacttgtcacatgcattagctctaaaagagggggtaaatacagttatgttccct
gttatgatggacatatgcaaagcaatgtgctccttggcaacacaaaattcaaccatccct
atgctgtcgcgaactcatggacagccagcatcgccaacaactctgggaaaagagatggcg
aattttgcggccagattgtcaagcataggaaatagtttttctgaggtcaagatactaggg
aaattcgctggagctgtcggaaattacaacgctgatgttgttgcatatccagaagttgac
tggcctaaggttgcagaagattttgtcaaatcgttgggcttggagttcaatccttatgtt
acccagattgagccacatgactatatctcgaagctcttcaatctatttgttcagtttaac
aatgtcttgactgatttcgatagagacatgtggacctatatatcactaggctacttcaag
cagatagtaaaggctggtgaagttggatcttccacaatgcctcacaaagtcaatcccatt
gatttcgaaaatagtgacggcaatttgactatagccaatggtacattgtcttctttaagc
atgaagctaccaatttctcggatgcagcgtgatctcacagactcgactgttttgagaaat
ttgggtgttggattagggcattcactcttggcttacaaagctacattgcgaggaatcaat
aaggttcaggtgaatgaatcccggttatctgaagacttggatcaaacatgggaggtcctt
gcagagccaatacagacagtgatgcgaaggtatggaatccctgaaccttatgagaagctg
aaggaaatgaccagagggcaggctgtcaccaaggacagcatacggcaattcattgaagat
ctagacttgccagaggcggcacgatcgtcgcttctgaagctaacaccacattcttatatc
ggagaggcagaatttttggctagaaatatcgaagaggtggttgatctaaaatctggattt
aagatcgagtga

DBGET integrated database retrieval system