KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332654
Entry
4332654           CDS       T01015                                 
Name
(RefSeq) galactinol synthase 1
  KO
K18819  inositol 3-alpha-galactosyltransferase [EC:2.4.1.123]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4332654
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.123  inositol 3-alpha-galactosyltransferase
     4332654
SSDB
Motif
Pfam: Glyco_transf_8 Mannosyl_trans3 Nucleotid_trans
Other DBs
NCBI-GeneID: 4332654
NCBI-ProteinID: XP_015628833
UniProt: Q10MB0 Q0DSD5
LinkDB
Position
3:11367194..11368903
AA seq 341 aa
MAPPQLAGKMTAKAAAAVKPATRAYVTFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVAVL
PDVPESHRRILISQGCIVREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYERMVYLD
ADIQVFDNIDELFELPKGHFYAVMDCFCEKTWSHTPQYQIGYCQQCPDKVAWPTAELGPP
PALYFNAGMFVHEPSMATAKSLLDTLRVTTPTPFAEQDFLNMFFREQYKPIPLIYNLVLA
MLWRHPENVQLEKVKVVHYCAAGSKPWRYTGKEANMDREDIKMLVKKWWDVYNDGSLDFK
GLPPIAAADDADEVEAAAKKPLRAALAEARTVKYVTAPSAA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctcctccccagcttgccggcaagatgaccgccaaggccgccgcggcggtgaagccc
gcgacgagggcgtacgtgacgttcctcgcgggcgacggtgactactggaagggcgttgtc
gggctggccaagggccttcgcaaggtgggctcggcctacccgctggtggtcgccgtcctc
cccgacgtgccggagtcccaccgccgcatcctcatctcccagggctgcatcgtccgggag
atcgagccggtgtacccgccggagaaccagacgcagttcgccatggcctactacgtcatc
aactactccaagctccgcatctgggagttcgtggagtacgagaggatggtgtaccttgac
gccgacatccaggtgttcgacaacatcgacgagctgttcgagctgcccaaggggcacttc
tacgcggtgatggactgcttctgcgagaagacgtggagccacaccccgcagtaccagatc
ggctactgccagcagtgccccgacaaggtggcgtggccgaccgccgagctcggcccgccg
ccggcgctctacttcaacgccggcatgttcgtgcacgagcccagcatggccaccgccaag
tccctgctcgacactctgcgcgtcaccacgcccactcccttcgcggagcaggatttcctg
aacatgttcttcagggagcagtacaagccgatcccactgatctacaaccttgtcctggcc
atgctctggaggcatccagagaacgtccagctcgagaaggtcaaggtcgtgcactactgc
gcagcgggatcgaagccgtggaggtacacgggcaaggaggcgaacatggacagggaggac
atcaagatgctggtcaagaagtggtgggacgtctacaacgacggcagcctggacttcaag
ggcctcccgcccatcgcggccgccgacgacgccgacgaggtcgaggcggcggccaagaag
ccgctgcgcgccgcgctggcggaggcccgcaccgtcaagtacgtcacggcgccatcggcc
gcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344351
Entry
4344351           CDS       T01015                                 
Name
(RefSeq) galactinol synthase 2
  KO
K18819  inositol 3-alpha-galactosyltransferase [EC:2.4.1.123]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4344351
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.123  inositol 3-alpha-galactosyltransferase
     4344351
SSDB
Motif
Pfam: Glyco_transf_8 Mannosyl_trans3
Other DBs
NCBI-GeneID: 4344351
NCBI-ProteinID: XP_015645380
UniProt: Q40710 A0A5S6R7K3
LinkDB
Position
7:complement(29220320..29221847)
AA seq 328 aa
MMGPNVSSEKKALAAAKRRAYVTFLAGDGDYWKGVVGLAKGLRRVRSAYPLVVAVLPDVP
GEHRRKLVEQGCVVREIQPVYPPESQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQ
VFDNIDHLFDLDKGAFYAVKDCFCEKTWSHTPQYDIGYCQQRPDEVAWPERELGPPPPLY
FNAGMFVHEPGLGTAKDLLDALVVTPPTPFAEQDFLNMFFREQYKPIPNVYNLVLAMLWR
HPENVDLDQVKVVHYCAAGSKPWRFTGKEENMNREDIKMLVKRWWDIYNDESLDYKEEED
NADEASQPMRTALAEAGAVKYFPAPSAA
NT seq 987 nt   +upstreamnt  +downstreamnt
atgatggggccgaacgtgtcgtcggagaagaaggcgttggcggcggcgaagaggagggcg
tacgtgacgttcctggccggcgacggcgactactggaagggcgtcgtggggctcgccaag
gggctccgccgcgtccgctcggcgtacccgctggtggtcgccgtgctcccggacgtcccc
ggcgagcaccggcggaagctggtcgagcaggggtgcgtggtccgggagattcagccggtg
tacccgccggagagccagacgcagttcgccatggcctactacgtgatcaactactcgaag
ctccgcatctgggagttcgtggagtacgagcggatggtctacctcgacgccgacatacag
gtgttcgacaacatcgaccacctgttcgacctcgacaagggcgccttctacgccgtcaag
gactgcttctgcgagaagacgtggagccacacgccgcagtacgacatcggctactgccag
cagcgccccgacgaggtggcgtggccggagcgcgagctcggccccccgccgccgctctac
ttcaacgccggcatgttcgtccacgagcccggcctcggcaccgccaaggacctgctcgac
gcgctcgtcgtcacgccgcccaccccgttcgccgagcaggacttcctcaacatgttcttc
cgcgaacagtacaagcccatccccaacgtctacaacctcgttctcgccatgctctggagg
cacccggagaacgtcgacctcgaccaggtcaaggtcgtccattactgtgcagcgggttcg
aagccatggaggttcaccgggaaggaggagaacatgaacagagaagatataaagatgctg
gtgaagaggtggtgggacatctacaacgacgagagcctcgactacaaggaggaggaggac
aacgccgacgaggccagccagccgatgcggacggcgctcgccgaggccggcgccgtcaag
tacttcccggcgccctccgccgcgtag

DBGET integrated database retrieval system