KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332674
Entry
4332674           CDS       T01015                                 
Name
(RefSeq) guanylate kinase 2, chloroplastic/mitochondrial
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332674
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     4332674
SSDB
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase Rad17 AAA_22 AAA_33 DUF5697
Other DBs
NCBI-GeneID: 4332674
NCBI-ProteinID: XP_015628708
UniProt: Q10M74
LinkDB
Position
3:11595455..11599070
AA seq 285 aa
MLLTRRFSSALARSPLLPRSLPPPRAVPATPPAPRPPPRRLMSSSSSGWHHSSRPPPPPP
SGADKDQLFRGLEAALGTTFSSEPLAPPPQPMILVISGPSGVGKDAVIQRLQEEREGMHF
VVTATSRAKRPGEVDGKDYYFVTKEEFLTMIERKELLEYALVYGEYKGIPKQQIRDYMAK
GYDIVLRVDIQGAATLREILGESAIFIFLVAESEEALVKRLIHRKTETSDMLLVRVATAR
EEVKRMNNFDYVVVNSEGNLEGAVKQVESIIDAEKAKVHKRTVNI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcttctcacgcgaaggttctcctccgccctcgcgcgctccccccttctccccaggtcc
ctccctcctccgcgggccgtgcccgccacccctccggcgccccgcccgccgccgcgccgc
ctcatgtcctcctcctcctccggctggcaccactcctctcgcccgcccccgccgcccccc
tccggcgccgacaaggatcagctgttccgggggctggaggcggcgctcggcacgacgttc
agctcggagccgctcgcgccgccgccgcagccgatgatcctcgtcatcagcgggcccagc
ggcgtcggcaaggacgctgtcatccagaggctgcaagaagagagggaggggatgcatttc
gttgtcaccgcgacaagcagagcgaagcggcccggtgaagttgatgggaaggactattac
ttcgtcaccaaggaggagttcctcacgatgattgaaaggaaggagttgctcgagtacgca
cttgtctatggggagtataaggggatccccaagcagcagatccgtgattacatggcgaaa
ggttatgatattgtcttgagagtggacattcaaggagcagcaaccttgagagagattctt
ggcgaatcagcaattttcatctttttggttgcagagagtgaagaggcacttgtcaaaagg
ctaattcaccgcaaaacagaaacatcagatatgcttcttgtcagagttgcaacggccaga
gaagaggtgaaacgcatgaacaattttgattatgtagttgtcaattctgaagggaatctt
gagggggctgttaaacaggtggagtctatcattgatgctgagaaggctaaggtccacaaa
cgtacggttaatatctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332721
Entry
4332721           CDS       T01015                                 
Name
(RefSeq) probable apyrase 1
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332721
   00240 Pyrimidine metabolism
    4332721
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4332721
SSDB
Motif
Pfam: GDA1_CD39 Ppx-GppA MDMPI_C
Other DBs
NCBI-GeneID: 4332721
NCBI-ProteinID: XP_015632681
UniProt: Q8H7L6
LinkDB
Position
3:complement(12021782..12027348)
AA seq 489 aa
MRRFSAAAGARQQQQQGEAVSDRVLRFRGVLVVVLAPVLLISLVLLLMPRAPASATVEGS
AGELVAAAGRRWGPRAVSGLGDGSTRYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIEL
FKQKKPGLSAYAMDPQEAAKSLVSLLEEAEKVIPVELREQTPVRVGATAGLRALGTEKSE
EILQAVRDLLQDKSSFRSQPEWVTVLDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLG
GGSVQMAYAISEKDAGKAPPVAEGEDSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILK
AGEGNDYRNCMLEGHHGQYRYGDDIFEASGLSSGASYSKCRAVAVRALKVDEPACTHMKC
TFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVK
DAQATYPDVSEENVPYLCMDLVYQYTLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLG
SAIEVASSS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgcgccgcttctcggccgccgccggggcgcggcagcagcagcagcagggggaggccgtg
tccgaccgcgtcctccgcttccgcggggtcctcgtcgtggtgctcgcgccggtgctcctc
atctcgctcgtgctccttctcatgcctcgcgcgcccgcctccgctaccgtcgagggctct
gccggtgagctcgtcgccgctgccggacggaggtggggcccccgggccgtcagcggactt
ggggacggatccaccaggtacgctgtgatatttgatgccgggagctccgggagccgcgtg
cacgtgtactgcttcgatgggaacctggatctgctgcctattggaaaggaaatcgagctg
ttcaagcagaaaaaaccaggcctcagtgcctatgccatggacccacaagaagctgctaag
tcacttgtttctcttctagaggaagctgaaaaagtaattcctgtggaattacgtgagcaa
actcctgtcagggttggggctactgcaggcctgagagcattagggactgaaaagtctgaa
gaaattttgcaagcggtaagggatcttcttcaagacaagagctctttcagatcccaacca
gaatgggttaccgttctagatggatctcaggaaggtgcattccagtgggttaccatcaat
tatctgttgggaaatttgggaaagccttactcacacacggttggagtggttgatctaggt
ggtggttctgtccaaatggcttatgccatctcagagaaggatgcaggaaaggctcctcca
gttgcagaaggtgaagattcatatgtgaaggagcttctacttaagggaacaacatattat
ctttatgttcacagttatttgcgttatggattgctggcggctagagcagagatcttaaaa
gcaggtgaaggcaatgattaccgcaactgtatgttggaaggacatcatggacaatacaga
tatggtgacgatatattcgaagcatcaggtttgtcatctggtgcaagttattccaagtgc
agggctgttgctgtgagagctctcaaagttgacgaaccagcatgcactcacatgaaatgt
acatttggtggtgtgtggaatggtggtggaggagatgggcagaagaatctttttgttgca
tcatttttcttcgatcgggctgctgaggccggttttgtaaacccgaaggcaccatttgct
aaggttaaaccctcagacttcgaagaagctgcacgacgtgtttgtaaactgaatgtgaag
gatgcacaggccacctacccggatgtttcagaggagaacgttccatacctttgcatggat
ctagtctaccagtacacgttacttgtggatggatttggtgtggatccctaccaggatatt
acattggtaaagaaggtgccttatagcaattcatttgttgaagcagcatggccccttggt
agtgccattgaggttgcatcttcatcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332967
Entry
4332967           CDS       T01015                                 
Name
(RefSeq) probable apyrase 6
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332967
   00240 Pyrimidine metabolism
    4332967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:osa04090]
    4332967
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4332967
CD molecules [BR:osa04090]
 Proteins
  4332967
SSDB
Motif
Pfam: GDA1_CD39 DUF5123
Other DBs
NCBI-GeneID: 4332967
NCBI-ProteinID: XP_015628174
UniProt: Q10KM6 Q0DRJ4
LinkDB
Position
3:14938457..14942284
AA seq 508 aa
MPDLTKPPSPRPRRRRCRLCGICLGTALLALLVSSLAHLFSPPQPQPQLQPPRPSPSSSP
PRFAVIIDGGSTGSRAHVFATGPGGRPDLARSAVMRVTPGLSSFADEPARAGDSLRPLID
FAREKVGGAAAEVRLMATAGLRLQEGRLQEAILSSCRDVLRASGFRFEDSWAEVIPGSDE
GIYAWVAANYALGTLGGDPHKTIGIIELGGASAQLTFVSDEVLPPELSRNFTFGGTTYTL
YSNSFLNFGQNAAQESFREILRSKDSKNGTLVDPCAPKGYSRIKEVISRPSSASKSKLEN
QFADSGDGDFTVCRSSSLALLKKGNEECRYQQCQLGPTFVPELRGHFLATENFYFTSKFF
GLKQSSSLSDFVLAGEQFCNKDLSTLRKMYPNRSDDDFSRYCFSSAYIVALLHDSLGVPL
DDKRIEYSNQVGDTQVEWALGAFISNIKGVIVEPSATGRSAHRSRPLLAVLLGVFLLGGA
LCLARWRKPKTKIIYDLEKGRYIITRIS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcccgacctcaccaaacccccttcccctcgcccccgccgccgccgctgccgcctctgc
ggcatctgcctcggcaccgcgctcctcgccctcctcgtctcctccctcgcccacctcttc
tccccgccgcagccgcagccgcagctgcagccgccgcggccctccccctcctcctcgcca
ccgcgcttcgcggtcatcatcgacggggggagcaccggcagccgggcgcacgtcttcgcc
acggggcccggcgggcggccggatctggcgcggtcggccgtgatgcgcgtcaccccgggg
ctctcctcgttcgccgacgagcccgcgcgggccggggattcgctgcggccgctgattgat
ttcgccagggagaaggtcgggggcgccgcggcggaagtgcggctcatggccaccgccggg
ctgcggctgcaggaggggcgcctccaggaggccatcctgtcgtcctgcagggacgtgctc
agggcttccggattccggttcgaggactcttgggccgaggtgatcccaggctctgatgag
ggtatctatgcttgggttgcggcaaactatgctcttggcacacttggaggggatccacac
aaaaccattggaataattgaacttgggggcgcctcagcacagctgacatttgtttctgat
gaagtacttcctccggaactgtcaagaaatttcacttttggtggaacaacatatactctc
tatagcaacagctttctaaactttggacaaaatgctgcacaagaatccttccgtgaaata
ctgcggtcaaaagactccaaaaatggtacacttgttgatccatgtgctcctaaaggatat
tctcgcatcaaagaagtaatatcaagaccaagcagtgcttcaaaatcaaaattagagaat
caatttgctgatagtggggatggagactttacagtgtgcagatcttcttctttggcactg
ctgaaaaaaggcaacgaagagtgccgatatcaacaatgccaacttggaccaacttttgta
cctgagcttcgtggacatttcttagcaactgaaaatttctattttacatcaaagttcttt
ggactgaagcaatcttcatcactgtctgattttgtgcttgctggagaacaattttgcaac
aaggacttgtctactcttaggaaaatgtatcctaatcggtcagatgatgatttttcacgt
tattgcttctcatccgcatatattgtagctctactgcacgacagtcttggtgtaccactg
gatgacaagaggattgagtattcaaatcaggttggagacactcaagttgaatgggccctg
ggggctttcatctcaaacataaaaggcgtaattgtagagccatcagcaactggtagatca
gcccatagaagtagaccattgcttgctgtgctgctgggggtgtttcttctaggtggagca
ctttgcttggcaagatggaggaagcccaagacgaagatcatatacgacttggagaaaggc
cggtacataatcacacgcatcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344315
Entry
4344315           CDS       T01015                                 
Name
(RefSeq) probable apyrase 2
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344315
   00240 Pyrimidine metabolism
    4344315
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4344315
SSDB
Motif
Pfam: GDA1_CD39 Ppx-GppA
Other DBs
NCBI-GeneID: 4344315
NCBI-ProteinID: XP_015647007
UniProt: Q6Z4P2
LinkDB
Position
7:28963032..28967281
AA seq 467 aa
MRRYSALPGGGARPDTLADRLHRYRGVLLVILAPLALVSLVLLLMPRSPASSSAAAGRRW
GPLDANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSEYANNPQEAA
KSLVSLLEDAKRVVPVELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQ
PDWVTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAP
KPSEGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQY
KYGNGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVA
SFFFDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMD
LVYQYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcgccgctactccgcgctgcccggcggcggcgcccgccccgacacgctcgccgaccgc
ctccaccgctaccgcggcgtcctcctcgtcatcctcgccccgctcgccctcgtctccctc
gtcctcctcctcatgccgcgctcccccgcctcctcctccgccgccgccggcaggaggtgg
ggccccctcgacgccaacaagtacgccgtcattttcgacgccgggagctccgggagccgc
gtccacgtcttccgcttcgacgccaacctcgatctgctccacattggcgaccagatcgag
ctcttcgtccagaaaaagccggggcttagcgagtacgccaataacccgcaggaggctgcc
aaatcgctcgtctctctccttgaggatgccaaacgagtggttcccgtggaattgcgcggc
cagactcctgttagagttggggccaccgccgggctaagagcgttgggagcagaaaaatca
gaggagattttgcaagcggtcagggatcttcttcgcgaaaagagttcgttcaagacccaa
ccggattgggttacagttcttgatggacctcaggaaggcgcatatgaatgggttaccatc
aattatctgctggggaaattgggaaagacttacgcagacacagttggagtggttgatctt
ggaggtggatctgtgcagatggcatatgcaattgcagagaaggatgcagtgaaggctcct
aaaccatcagagggtgaagattcatatgtgaagaaactgtttcttaaaggaacaacatat
tatctttatgttcacagctatttgcattatgggttgctggctgctagagcagagatctta
aaagccggcaatggcaaaggttacagctactgtacattggaggggcatcaagggcaatac
aaatatggcaatggcaaatttgaagcgtcggcttcaccatctggtgctagttattcaaaa
tgcagggatgatgtagtgaaagctcttaaagttgaccaagcatgcactcacatgaaatgt
tcttttggtggcatttggaatggtggtggtggcgctggacagaagaatttgtttgtggca
tcatttttcttcgacagggcagctgaggctggatttgtgaatcccaaggcacctgtggct
aaggttaaaccttcagattttgaaaaggctgccaagcgtgcatgtaagttaaacttgaag
gacgccgaagctgcctaccctggtgtccaaaaggataacattccatatatctgcatggat
ctcgtttaccagtacaccttacttgtggatggatttggtgttggttctcaccaagagatg
accttggtaaagaaagtcccttacagcaacgcgtttgtggaagcagcatggccactggga
agtgccattgaggttgcatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345665
Entry
4345665           CDS       T01015                                 
Name
(RefSeq) probable apyrase 5
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4345665
   00240 Pyrimidine metabolism
    4345665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:osa04090]
    4345665
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4345665
CD molecules [BR:osa04090]
 Proteins
  4345665
SSDB
Motif
Pfam: GDA1_CD39 RskA
Other DBs
NCBI-GeneID: 4345665
NCBI-ProteinID: XP_015651078
UniProt: A0A0N7KPX0 Q6Z543
LinkDB
Position
8:21190181..21194323
AA seq 537 aa
MRRPNARAHHPRGESQEAAATTLAPPPRPTISSAMGSRRARGRRLLAALLAAAFAVALLL
LVPRSPRRRPHEYGVVIDAGSTGSRVHVIAYRSSSSSPASALPRIDWARTASMKAAPGLS
SFASDPGGAGRSLAPLLEFARRRVPPESWAETDVRLMATAGLRLLDAAVAEAVLDSCRVL
LRGSGFQFQDDWATVISGAEEGMYAWIAANYALGTLGDDSQDTTGIIELGGASVQVTFVT
DKPLPPEFSHTLKFGDATYNLYSHSFLQLGQNVAYESLHDMLSTPGHKSMATHLISQAKY
RDPCTPRGFSPMEGAVKLPASVLESKVEYRPYAHAVGNFSECRSAALTLLQKGREECRYH
ECRMGAAFVPDLDGKFLATENFYHTSKFFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYR
SFNEGELLLFCFSSAYIVALLHDTLKVPLDDKRIDVANQIGGVPVDWALGAFIVQKASNQ
TDMLHPEGEKISPEDGIRHGERPVHHNQGETMSLARRRWDLVELLRWGASDRVCKFS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcgccgccccaatgcccgcgcccatcacccgcgtggcgaatcgcaggaggcggcggcg
acaaccctagctcctcctcctcgtccgaccatttcctccgcgatgggctcccgccgcgcc
cgcggccgccgcctcctcgccgccctcctcgccgccgcgttcgccgtcgcgctcctcctg
ctggtgccccgctcgccgcgtcgtcgtccccacgagtacggcgtcgtcatcgacgccggt
agcacggggagccgcgtccacgtcatcgcctaccgctcctcctcctcctcccccgcctcc
gcgctcccgcggatcgactgggcgcgcacggcgtcgatgaaggcggccccggggctgtcg
tccttcgcctccgacccgggcggcgcgggccggtcgctggcgccgctcctggagttcgcg
cgccgccgcgtgccgccggagagctgggcggagaccgacgtgcgcctcatggccaccgcg
gggctccggctgctcgacgccgcggtggccgaggctgtgttggattcgtgcagggtgttg
ctgcggggatcggggttccagttccaggacgattgggccaccgtgatctcaggagctgag
gaagggatgtatgcatggattgcagcaaattatgcgctgggtaccctaggcgatgactca
caagatactacggggataattgagcttggtggagcttccgttcaggtaacttttgttacg
gacaaacctttgcctccagagttctctcatactctgaagttcggtgatgccacatataat
ctgtacagtcacagctttctacaacttggtcagaatgttgcgtacgaatcactccatgac
atgctgagcacacctgggcataaatcaatggcaacacatttaatttctcaagctaagtac
agagatccttgcactccaaggggattttcgcccatggagggagcagttaaacttcctgcc
agtgttcttgagtcgaaggttgagtacagaccttatgctcatgctgttggtaacttctcc
gaatgtagatctgcagcactaacactattgcagaaaggaagagaggaatgtaggtaccat
gaatgccgtatgggagcagcatttgtaccagaccttgatgggaaatttttagcaacagag
aatttctaccatacttccaagttctttaggttgcgttctaagtcttttctttctgacctg
atgctggctggggagaaattttgccgaggagactggtcaaagattaaaaaggagtaccgt
tctttcaatgagggggagctgcttcttttttgcttttcctcagcatatattgttgctttg
ctgcatgatactctaaaggtcccgctggatgataagaggattgatgttgcgaatcaaatt
ggcggtgtgcctgttgactgggcattgggtgctttcattgtgcagaaggcgtcaaaccag
acagacatgctccatcctgagggggagaagatctcgcctgaagacggtatacgacatgga
gaaaggccggtacatcataaccagggtgagacgatgagccttgcgcgtcgtcgctgggat
ttggtggagctcctgcggtggggtgccagtgatcgtgtttgtaaattctcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349645
Entry
4349645           CDS       T01015                                 
Name
(RefSeq) probable apyrase 3
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4349645
   00240 Pyrimidine metabolism
    4349645
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4349645
SSDB
Motif
Pfam: GDA1_CD39 Peripla_BP_4 Ppx-GppA
Other DBs
NCBI-GeneID: 4349645
NCBI-ProteinID: XP_015616582
UniProt: A0A0N7KSD1
LinkDB
Position
11:1202650..1206414
AA seq 464 aa
MAAHHVMSIAAAAVAMLLLMASSPAVAGTAVLGRKGGAMTDDDVVGGQAATGPGKYAVIL
DAGSTGTRVHVFRFDRMMDLLKIGDDIEVFAKVVPGLSSYAGRPREAANSIQPLLDKAIH
VVPNWLMKKTPLKLGATAGLILIGDEKANQILEAVRDVVHTKSKFQYNPNWINVLTGSQE
GSYMWVALNYLLDRLGEDYSKTVGVIDLGGGSVQMAYAVSSSIAANAPEVPNGQDPYITE
EYLKGRDYNIYVHSYLHYGAQASRVEILKRKNGPFSNCMLRGFKGKFTYNGEQYEAMAAP
QGADYHKCRQDVVKALNLDSPCETKNCSFNGVWNGGGGVGQDEIYVTSSFYYIASGIGFI
DSEAPSAKSTPAAYKAASEKVCILSIEEAKAAYPIARDHAYLCMDLIYQYTLLVDGFGLE
ATKEITLVEKVKHGESYIEAAWPLGTAIEVISPKKKHQEPGRSS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcggctcatcatgtcatgagcatcgccgcagcagcagtagccatgcttctcctgatg
gcgtcgtcgccggcagtcgccggcacggcggtgctcggccggaagggcggcgccatgact
gacgacgatgtcgtgggagggcaggcggcgacagggccggggaagtacgccgtgatattg
gacgccggcagcacggggacgagggtacacgtctttaggttcgacaggatgatggatctt
ctcaagatcggcgacgacatcgaggtcttcgccaaggtggttcctggactgagctcgtac
gctggacgaccgcgggaggcagccaactccatacagcctctgcttgataaggccatccac
gttgtccctaactggcttatgaagaaaactccccttaaacttggggcaactgctggactc
atacttattggagatgaaaaggcaaaccagattcttgaagcggtcagagatgttgtccac
accaagagcaaatttcagtacaatccaaactggatcaatgttcttacgggatctcaagaa
ggatcttacatgtgggttgctcttaactatcttcttgatagactgggtgaagattactcg
aaaacagtaggcgtgattgatcttggaggtggatccgtacaaatggcctatgccgtctca
tcaagcattgctgctaacgccccagaggtgcctaatgggcaggatccctatattacagag
gagtatcttaaagggagagattacaacatttatgtgcacagttacttgcattatggcgct
caggcttctcgcgtagagatactgaagagaaagaatgggccatttagcaactgcatgttg
cgtggattcaaaggcaaattcacctacaacggggagcagtacgaagcaatggcagcacca
caaggtgcagactaccacaaatgcagacaagatgtggtgaaggcactgaacctagactcg
ccctgcgaaaccaaaaattgcagcttcaacggcgtgtggaacggcggcggcggcgttggg
caggacgagatctacgtcacatccagcttctactacatagcctccggtattgggttcatc
gacagtgaggcgcccagtgcaaagtctacaccagcagcgtacaaggctgcatcagagaag
gtttgtatactgagcatcgaagaagcgaaagcagcatacccaatagctcgtgatcacgcc
tacttatgcatggatctcatctatcaatacaccttgcttgtcgatggcttcggtttggaa
gcaacgaaggagattactctggtagagaaggtgaagcatggagagtcctacatagaagca
gcgtggccattgggcactgccattgaggttatctcgcccaaaaagaagcatcaagagcct
ggccggagtagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349647
Entry
4349647           CDS       T01015                                 
Name
(RefSeq) probable apyrase 3
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4349647
   00240 Pyrimidine metabolism
    4349647
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4349647
SSDB
Motif
Pfam: GDA1_CD39 Ppx-GppA
Other DBs
NCBI-GeneID: 4349647
NCBI-ProteinID: XP_015615706
UniProt: B9GBL8
LinkDB
Position
11:1222788..1226652
AA seq 457 aa
MAFHHVMGIVAAMLLLMASSPAVADTAVLGRKGGAMTDDDAVEGEATTGPGRYAVILDAG
STGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMPLLDRANHAVP
TWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWINVLSGSQEGSY
MWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDGQDPYIIKEYL
KERDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQYDATAAPQGA
DYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYMASDIGFIDSE
APSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRACDHAYLCMDLVYQYTLLVDGFGLEATK
EMTLVEKVKHGEYYIEAAWPLGTAIEAVSPKKKHQET
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcgtttcatcacgtcatgggcattgtagcagccatgcttctcctgatggcgtcgtcg
ccggccgtcgccgacacggcggtgctcggccggaagggcggcgccatgactgacgatgat
gccgtggaaggagaagcaacgacggggccggggaggtacgccgtgatattggacgccgga
agcacgggcacacgagtgcacgtcttcaggttcgacaagaagatagacctcctcaagatc
ggcgacgacatcgaggtctttgccaaggtggatcccgggctgagctcgtacgctgggcgg
ccgcaagaggcagcaaaatccataatgcctctgcttgacagggccaaccacgctgttcct
acctggcttatgaataaaactccccttgaacttggggcaactgctggactcagacttatt
ggagatgacaaggcaaaccagattcttgaagcggttagagatgttgtccacaccaagacc
aagttccaatacaatccaaactggattaatgttcttagtggatctcaagaaggatcttac
atgtgggttgcacttaactatttgctggatagattaggaggtgactactccaaaactgta
ggagtgattgatctcggaggtggatccgtgcaaatggcctatgccatctcaacaggcaca
gctgctaatgctccagaagtgctcgatgggcaggatccttatattataaaggagtatctc
aaagaaagagattacaatgtttatgtgcacagttacttgcactatggtgctcgggcttct
cgcgtggagatactaaaaaggaagaatgggacatttagcaactgcatgctgcgtggattt
agcggtaagtacatctataacggggagcagtatgatgcaacggcagcgccacaaggggca
gactaccacaagtgtagagatgacgtggtgaaggcactcaacctggacgcgccttgcgaa
accaacaactgcagcttcaacggagtgtggaacggcggcggtggcgctgggcaggacgag
ctctacgttgcgaccagtttctactacatggcctcggatattgggttcatcgatagcgag
gctcctagtgctaagtccacaccagcagcatacaaggttgctgcagaaaaagtttgcagt
ctgagtgttgaagaagcgaaagcagcataccccagagcttgtgaccatgcttatctatgc
atggacctcgtttaccaatacaccttgcttgtcgatggctttggtttggaggcaacgaag
gagatgacgctggtagagaaggtgaagcatggagagtactacatcgaagcggcgtggcca
ttgggcaccgccattgaggctgtctcacccaaaaagaagcaccaagagacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350420
Entry
4350420           CDS       T01015                                 
Name
(RefSeq) probable apyrase 3
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4350420
   00240 Pyrimidine metabolism
    4350420
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4350420
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 4350420
NCBI-ProteinID: XP_015616507
UniProt: Q53KM3 A0A0P0Y1S8
LinkDB
Position
11:complement(14390248..14398506)
AA seq 475 aa
MARSAVLLHAVLLVLAVAVSSWRGVVSGDAAVVLGRKAAGMSSAAASSSADDDLPALQIS
ARKDGAGNDKYAVIFDAGSTGSRVHVFRFDKQMDLVKIGDDMELFAKVKPGLSSYAGKPQ
EAANSIAPLLEKAKGVVPKQLQKRTPLKLGATAGLRLIGDEKSEQILEAVRDLVHSKSNF
QYKPEWISVLGGSQEGSNLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISSDAAE
NSPPVPVGKDPYVTKEYLKGKDYNLYVHSYLHYGLQASRVEILKTKNGQFSSCMLREFNG
TYKYNGEEYDAAASPEGADHGKCGEEAAAALGLDAPCESRNCSFNGVWNGGGGAGMADLY
VASYFYDRAVHGGFVVDDAPSAVTTPAAFAEAASKACSLSSGEAAAAYPEAFDVQFICMD
LTYQYTLLTKGFGLKPTREMTLVKQVKYGDCYVESAWPLGTAIEALSSQKSHQSA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcacgctccgccgtgttgttgcacgccgtcctcctcgtcctcgccgtcgcggtgtcg
tcgtggcgtggcgtggtctccggcgacgcggcggtggtgctcggccggaaggccgccggg
atgagtagtgctgcagcgtcgtcgtcggccgacgacgacctgccggcgctgcagatctcg
gcgaggaaggacggcgccgggaacgataagtacgccgtgatcttcgacgccggcagcacc
gggagccgggttcacgtcttcaggttcgacaagcagatggacctcgtcaagatcggcgac
gacatggagctcttcgccaaggtgaagcccgggttgagctcatatgctggcaaaccacag
gaagctgcaaactccattgctcctctgctagagaaggctaaaggtgttgttcccaagcag
cttcagaaaagaactcccctcaaacttggggccactgctggtctaagactgattggagat
gagaagtcagagcaaattcttgaagcggttcgagatcttgtccacagcaagagcaatttc
cagtacaaaccagaatggatcagtgtccttgggggttctcaagaaggatccaacctctgg
gttgctctgaactatcttttggggaagttaggaggggattactcaaaaaccgtaggagtg
atcgatctcggaggtggttcagttcaaatggcctatgccatttcttcagatgctgcagaa
aactctcctccagtccctgtcggcaaagatccttatgttacaaaggagtatctcaaggga
aaagattataacctttatgttcacagttacttgcattatgggctccaagcttctcgcgtc
gagattcttaagacgaagaatgggcaattcagctcctgcatgcttcgcgaattcaatggt
acatacaagtacaacggcgaggagtacgacgcggcggcgtcgccggaaggggcggaccac
ggcaagtgcggcgaggaggcggcggcggcgctgggcctggacgcgccgtgcgagtcccgg
aactgcagcttcaacggcgtgtggaacggcggcggcggcgccggcatggccgacctctac
gtggcgtcctacttctacgacagggcggtgcacggcgggttcgtcgtcgacgacgcgccg
agcgccgtgaccaccccggcggcgttcgcggaggcggcgtcgaaggcctgctcgctgagc
tccggcgaggccgcggccgcgtacccggaggcgttcgacgtgcagttcatatgcatggac
ctgacgtaccagtacacattgcttacaaagggcttcggtttgaagccaactagggagatg
acgcttgtgaaacaggtcaagtatggggattgctacgtggagtcggcgtggccgctgggt
actgccatagaagccttgtcctcccagaagagtcatcagtctgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351367
Entry
4351367           CDS       T01015                                 
Name
(RefSeq) probable apyrase 3
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4351367
   00240 Pyrimidine metabolism
    4351367
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     4351367
SSDB
Motif
Pfam: GDA1_CD39 Ppx-GppA
Other DBs
NCBI-GeneID: 4351367
NCBI-ProteinID: XP_015620056
LinkDB
Position
12:1097965..1110494
AA seq 477 aa
MDGGFSGLATREGTSAASGQATAQLAMAADHLVVAMLLLLALSPPAVADDTAVLGRKGGV
VEGQAAGPGRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDNIELFAKVDPGLSSYAGRPQ
DAANSILPLLDKANTVVPARLMNKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKY
QYNPNWINVLEGSQEGSYIWVALNYLLDKLGGDYSKTVGVVDLGGGSVQMAYAISSNTAA
TAPKVPEGKDPYVVKEYLKGKDYNIYVHSYLHYGGFASRAHILERKDGPFSNCMLRGFSG
NFTYNGKQYDATAAPQGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLY
VASAFYYIASHVGFINSDAPSAKSTPATFKAVAEKVCKLSVKEAKVEYPNVRDHAYLCMD
LIYEYSLLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVSPKKRLREIYK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggatggagggttttctgggcttgccactcgtgaaggaacatctgctgcctctggacaa
gctacggcccagttagcaatggcggctgatcaccttgtcgtggccatgcttctcctgctg
gctttgtcgccgccggccgttgctgacgacacggcggtgctcggccggaaaggcggcgtc
gtggaagggcaggcggcggggccggggaggtacgccgtgatattggacgccggcagcacc
ggcacacgggtgcacgtcttcaggttcgacaacaagctggacctcctcaaggtcggcgac
aacatcgagctcttcgctaaggtggatcctgggctgagctcctacgctggacgtcctcag
gatgccgcaaactccatattgcctctgcttgacaaggccaacaccgttgttcctgccaga
cttatgaacaaaactccccttaaacttggggcaactgccggactcagacttattggagat
gaaaaggcgaaccagattcttgaagcggttagggatgtagtccacaccaagagcaaatat
cagtataacccgaactggatcaacgttcttgagggatcccaggaagggtcatacatatgg
gttgctctgaattatctcctggataaattgggaggagactactctaaaaccgtaggggtg
gttgatcttggaggtggatccgtacaaatggcatacgccatctcatcaaacaccgctgct
accgctccaaaggtgcccgaaggaaaagatccctatgttgtgaaggagtatctcaaggga
aaagattataacatttatgtgcacagctatttgcactatggcggttttgcttctcgcgcg
cacatcctagagagaaaggatggaccatttagcaactgcatgctgcgcggattcagtggt
aacttcacctacaacggcaagcagtacgacgcaacggccgcaccacaaggtgcagactac
cacaagtgcagagaagaagtagtgaagttactgaaggtgaatgcgccctgcgaaaccaag
aactgcagcttcaatggcgtctggaacggtggtggcggagcagggcaggatgacctctac
gttgcgtccgccttctactacatagcctcccatgttgggttcatcaacagcgatgcaccc
agtgcgaagtcaacccctgcaacgtttaaggctgttgcagaaaaggtttgtaaactgagt
gtcaaagaagcaaaagtagaataccccaacgttcgtgatcatgcctacttatgcatggat
cttatctacgaatactccttgctcgttgacggcttcggtctacatccaagtaaggagata
acgctggtagacaaggtgaagcatggggagtactacattgacgcggcttggccattgggt
acagctattgaagctgtgtcacccaaaaaacggcttcgagaaatatacaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352344
Entry
4352344           CDS       T01015                                 
Name
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4352344
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     4352344
SSDB
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 RsgA_GTPase AAA_17 Rad17 MMR_HSR1 ATPase_2 ABC_tran NTPase_1 AAA_7 RNA_helicase AAA_14 T3SS_needle_E ResIII NACHT
Other DBs
NCBI-GeneID: 4352344
NCBI-ProteinID: XP_015620685
UniProt: Q2QPW1
LinkDB
Position
12:complement(20028820..20032866)
AA seq 382 aa
MGEEAPEFRVESVALESKDCLQNAIDIGDKTYVISRSDDPKSSITIKILDKLTQTWVVPT
VLGAPPNPTSSHSAVLVNNEKILIIEKGVPLNDSIWFLEVDTPFVKQQSKIKGTVVVAWS
KGVIGEGQKPIVISGPSGVGKGTLIAKLMKEYPSKFGFSVSHTTRAPREKEIDGVHYHFT
ERSKIEEEISEGKFLEFAHVHGNVYGTSVEAVESVTDEGKRCILDIDVQGARSVRASSLE
AIFIFVCPPSFEELEKRLRARGTETEEQIQKRLRNARAELDQSNSPGLFDHLLVNDDLEA
CYENLKKLLSLDDDHEDSNDSFIKDGKETACYSILSKTNSEILLQSETNEAEKGTTNLLS
LDLSLSGGAPGRTRGLKISPVN
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgaagaggctccggagtttcgtgtcgagagcgtcgccttggaatccaaggactgc
ctgcagaatgccatagatataggcgataagacgtatgttatcagcagatcagatgacccc
aagtcatcgattaccatcaaaattttggacaaactaactcagacttgggttgtacctaca
gtacttggggcacctccaaatccaaccagctcacactcagcggttctcgtaaacaatgag
aagatactgattattgagaagggtgttcccttgaatgattctatctggttccttgaggta
gacactccttttgttaagcagcagagcaaaattaagggcacagttgttgttgcatggagc
aagggagtaattggtgagggccaaaagccaattgtgattagcgggccttctggtgttggt
aaagggacattaattgcaaaattaatgaaagaatatccatcaaagtttggattttctgtt
agccacaccacaagagctccaagggagaaagaaatagatggagttcattaccacttcaca
gaacgaagcaagattgaggaagagataagtgagggcaaatttcttgagtttgctcatgtt
catggaaatgtctatggcactagcgttgaagcagttgaatctgttactgatgaggggaag
aggtgtattctcgacattgatgtccaaggagctcgttctgtgagggcttcttctcttgaa
gcaatattcatctttgtatgccctccatcgttcgaggaactagagaagcgccttcgggca
cggggaactgaaacagaggagcaaatccagaagcgactgaggaatgctcgtgcagagctt
gaccagtccaattcaccaggtcttttcgatcatcttttggtaaatgatgaccttgaagct
tgttatgaaaatttgaagaagttgctttctttggatgatgaccacgaagattcaaatgat
tctttcatcaaggacgggaaagaaactgcatgttactcaatcctgtccaaaacaaactca
gaaattttgttgcaatctgagactaacgaagcagagaaaggaaccacaaacttgttatcg
ctcgacttgtctctctcaggaggtgctcctggacgaacaaggggcctcaagatatccccg
gttaactag

DBGET integrated database retrieval system