KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332690
Entry
4332690           CDS       T01015                                 
Name
(RefSeq) magnesium-chelatase subunit ChlH, chloroplastic
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4332690
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4332690
SSDB
Motif
Pfam: CobN-Mg_chel DUF3479
Other DBs
NCBI-GeneID: 4332690
NCBI-ProteinID: XP_015631165
UniProt: Q10M50
LinkDB
Position
3:11712161..11718963
AA seq 1387 aa
MSSLVSTPFTTATGVQKKLGAPVPLHSFLLSRRQPAAGAGRGRAAAAAIRCAVAGNGLFT
QTKPEVRRVVPPEGDASRRGVPRVKVVYVVLEAQYQSSVTAAVRELNADPRRAAGFEVVG
YLVEELRDEETYKTFCADLADANVFIGSLIFVEELALKVKDAVEKERDRMDAVLVFPSMP
EVMRLNKLGSFSMSQLGQSKSPFFQLFKRKKNSGGFADSMLKLVRTLPKVLKYLPSDKAQ
DARLYILSLQFWLGGSPDNLQNFLKMIAVSYVPALKGADIKYDDPVLFLDAGIWHPLAPT
MYDDVKEYLNWYGTRRDTNDKLKDPNAPVIGLVLQRSHIVTGDDGHYVAVIMELEAKGAK
VIPIFAGGLDFSGPTQRYLVDPITGKPFVNAVVSLTGFALVGGPARQDHPKAIAALQKLD
VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHAL
HKRVEQLCTRAIRWAELKRKTKEEKKLAITVFSFPPDKGNVGTAAYLNVFNSIYSVLQDL
KKDGYNVEGLPDTAEALIEEVIHDKEAQFNSPNLNVAYRMNVREYQSLTSYASLLEENWG
KPPGNLNSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFVE
KIFQADAVLHFGTHGSLEFMPGKQVGMSDACYPDSLIGNIPNIYYYAANNPSEATVAKRR
SYANTISYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIISTAKQCNLDKD
VPLPEEGVELPPNERDLIVGKVYAKIMEIESRLLPCGLHVIGEPPSAIEAVATLVNIASL
DRPEDEIYSLPNILAQTVGRNIEDVYRGSDKGILADVELLRQITEASRGAITTFVERTTN
NKGQVVDVTNKLSTMLGFGLSEPWVQHLSKTKFIRADREKLRTLFTFLGECLKLIVADNE
LGSLKLALEGSYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAALKSAKIIVDRLLE
RQKVDNGGKYPETIALVLWGTDNIKTYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEE
LGRPRIDVVINCSGVFRDLFINQMNLLDRAVKMVAELDEPEEMNYVRKHAQEQARELGVS
LREAATRVFSNASGSYSSNVNLAVENASWTDEKQLQDMYLSRKSFAFDCDAPGAGMREQR
KTFELALATADATFQNLDSSEISLTDVSHYFDSDPTKLVQGLRKDGRAPSSYIADTTTAN
AQVRTLSETVRLDARTKLLNPKWYEGMMKSGYEGVREIEKRLTNTVGWSATSGQVDNWVY
EEANATFIEDEAMRKRLMDTNPNSFRKLVQTFLEASGRGYWETSEENLEKLRELYSEVED
KIEGIDR
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgtcgtctttagtgtcgacgccgttcacgacggcaaccggggtgcagaagaagctgggg
gcgcccgtgccgctccactcgttcttgctgagccggcggcagccagcggcgggcgcgggg
aggggacgcgcggcggcggcggcgatacggtgcgcggtggccgggaacgggctgttcacg
cagaccaagccggaggtgcggcgcgtggtgccgcccgagggcgacgcgtcgcggcgcggg
gtgccgcgggtgaaggtggtgtacgtcgtgctggaggcgcagtaccagtcgtcggtgacg
gcggcggtgcgggagctcaacgccgacccgcgccgcgcggcggggttcgaggtggtgggc
tacctcgtggaggagctccgggacgaggagacgtacaagaccttctgcgccgacctcgcc
gacgccaatgtgttcatcggctcgctcatcttcgtggaggagctcgcgctcaaggtgaag
gatgccgtcgagaaggagcgcgaccggatggacgccgtgctcgtcttcccgtcgatgccg
gaggtcatgcgcctcaacaagctcggctccttcagcatgtcccagctcggccagtccaag
agcccattcttccagctcttcaagcgcaagaagaactccggtggcttcgccgatagcatg
ctcaagctggtgcgcacgctgcccaaggtgctcaagtacttgccctccgacaaggcgcag
gacgcccggctgtacatcctcagcctccagttctggctcggaggctcgccggacaacctc
cagaatttcctcaagatgatcgccgtctcctacgtgccggcgctcaagggcgccgacatc
aagtacgacgaccccgtcctcttcctcgacgctggtatctggcacccgctggcgcccacc
atgtacgacgacgtcaaggagtacctcaactggtacggcacccgccgcgacaccaacgac
aagctcaaggaccccaacgcgccggtgatcggcctcgttttgcagaggagccacattgtc
accggagacgacggtcactacgtcgccgtgatcatggagctggaggccaagggtgccaag
gtcataccgatcttcgccggcgggctggacttctcgggacccacgcagcggtacctcgtc
gacccgatcaccggaaagccgttcgtgaacgcggtggtgtcgctcaccgggttcgcgctc
gtcggagggccagcgaggcaggaccatcccaaggcgatcgccgcgctgcagaagctcgac
gtgccgtacatcgtggcactgccgctcgtgttccagacgacagaggagtggctgaacagc
acattgggcctgcacccgattcaggtggcgctgcaggttgcgctcccggagcttgacggt
ggcatggagcccattgtgttcgccggccgtgaccccagaacagggaagtcacatgcgttg
cacaagagggtggagcagctctgcactagagcaatcagatgggcagagctgaagaggaaa
actaaggaggagaagaaactggcaatcactgttttcagcttcccaccagacaaaggcaat
gttggcacagcagcatacctgaatgttttcaactccatctactccgtcctccaagatctg
aagaaggatggctacaatgttgagggtcttccagacacagctgaggccctcatcgaggag
gttattcatgataaggaggcccaattcaatagccccaacctcaatgttgcttaccgcatg
aacgtgcgggagtaccagtcactcacttcctatgcctccttgctggaggagaactggggc
aagccacctgggaaccttaattctgatggtgaaaacctccttgtctatgggaaacagtac
ggcaatgtattcattggagttcagcccacttttggctatgaaggagatccgatgcggctt
ctgttctcaaaatctgctagccctcaccatggctttgcagcatactacacctttgttgag
aagatcttccaggctgatgctgttcttcactttggtacccatgggtctcttgagttcatg
ccagggaagcaggttgggatgagtgatgcatgctatcctgacagtctcattggcaacatc
cccaatatctactactatgcagcaaacaatccatcagaagcaactgttgccaagcgcaga
agctatgcaaacaccataagctacctgacaccaccagctgaaaatgctggtctctacaag
gggctcaagcagctttcagagctcatctcttcttaccaatctctcaaggacacaggacgt
ggtccgcagattgtgagctcaatcattagcactgcaaaacagtgtaatcttgacaaggat
gttcccttgcctgaggaaggtgtggagcttccaccaaatgagcgtgaccttattgttgga
aaggtgtatgccaagatcatggaaatagaatcacgcctcctaccatgcggtctgcatgtg
ataggtgagccaccaagtgccatcgaggctgtggccaccttggtgaacatagcttccctt
gatcgcccagaggatgaaatatactcactgcctaacatacttgctcagacagtgggcagg
aacattgaagatgtgtacagaggaagtgacaagggaatactggcggatgttgaactgttg
aggcagataacagaagcttcacgtggtgccatcactacctttgttgagaggactacaaac
aacaaagggcaagttgttgatgttacaaacaaacttagtaccatgcttggttttggttta
tcagaaccatgggtacaacacttgtccaagaccaagttcatcagagcagacagagagaaa
ttgagaaccttgtttactttcttgggagaatgcttgaagctaattgtggcagataatgag
ctgggaagcttgaaacttgccctcgagggaagctatgttgaacctggccctggtggtgat
ccaatccgtaacccgaaggttctcccgacagggaagaacatccatgctcttgaccctcag
gcaatcccaactacagctgccttgaagagcgccaaaattattgtagaccgtctgctggag
cggcaaaaggttgacaatggtggcaagtatcctgagacaattgcacttgtcttgtggggc
accgataacatcaagacctatggtgagtcattggcccaggtgctgtggatgattggtgtg
cgcccggttgctgacacctttggccgtgtcaaccgtgtggaacctgtcagccttgaggag
cttggacgtcccaggattgacgttgttatcaactgctcgggtgtcttcagagatcttttc
atcaaccagatgaatctactggaccgggcagtgaagatggttgccgaactggatgagcca
gaagagatgaactacgtgcgtaagcatgcacaagagcaggcacgggaacttggcgtttca
ttaagagaggcggcaacaagggtgttctcaaatgcatcaggctcttactcatcgaatgtg
aacttggcagtggagaatgcatcatggactgatgagaagcagctccaggacatgtacctg
agtcgcaagtcttttgcatttgattgtgatgctccaggggcaggcatgcgagagcaacgc
aagacatttgagcttgctctagcaacagcagatgccacattccagaacctagactcatca
gagatttcactaacagatgtgagccactactttgactcagacccgacaaagctggtgcaa
ggactgcgcaaggatgggcgggcaccttcctcatacatagcagatacaaccacagcaaat
gcacaggtgaggacattgtcagagacagtgcgccttgatgcaaggacaaagctactgaac
cctaagtggtacgaggggatgatgaaaagtggctacgagggagttagagagattgagaag
cggctgacaaatactgttggatggagtgcaacatctggacaggttgacaactgggtttat
gaggaggcaaatgccacatttattgaagatgaggctatgaggaagaggctcatggacacc
aaccccaattcattcaggaagctagttcagaccttcctagaagccagtggcagaggctac
tgggagacatcagaggaaaacttggaaaagctcagggagctctactctgaggttgaagac
aagattgaaggaattgaccggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333259
Entry
4333259           CDS       T01015                                 
Name
(RefSeq) magnesium-chelatase subunit ChlI, chloroplastic
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4333259
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4333259
SSDB
Motif
Pfam: AAA_lid_2 Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat bpMoxR AAA DUF815 AAA_7 AAA_29
Other DBs
NCBI-GeneID: 4333259
NCBI-ProteinID: XP_015627981
UniProt: Q53RM0
LinkDB
Position
3:complement(20248212..20250141)
AA seq 415 aa
MASAFSPATAAPAASPALFSASTSRPLSLTAAAAAVSARIPSRRGFRRGRFTVCNVAAPS
ATQQEAKAAGAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTV
RSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLEGEKLPVVTAKITMVDLPLGATE
DRVCGTIDIEKALTDGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTV
EREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFD
RDPKAFRESYLEEQDKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTN
RAAKALAALKGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcttccgccttctcccccgccaccgccgcgcccgccgcgtcgccggccctcttctcc
gcctccacctcccggcctctctccctcaccgccgccgccgctgccgtctcagcccgtatc
ccgtcacggagagggttccgccgcggccgcttcaccgtctgcaatgtagccgccccctcc
gccacccagcaggaggctaaggcggcgggcgcgaaggagagccaacggccggtgtatccg
ttcgcggcgatcgtggggcaggacgagatgaagctgtgcctgctgctcaacgtcatcgac
cctaagatcggcggtgtcatgatcatgggagaccgtggcaccggcaaatccaccaccgtc
cgctcgctcgtcgacctgctcccggatatccgcgtcgttgttggcgaccctttcaattcc
gaccctgacgatcccgaggtcatgggccctgaggtccgggaacgcgtgctggagggtgag
aagcttcctgttgtcacggccaagatcaccatggtagatcttccccttggtgccactgag
gatagagtctgtggcaccattgatattgagaaggcgctcaccgatggtgtcaaggcgttc
gagcctggtttgcttgccaaggccaacagggggattctttatgtggatgaggtcaatttg
ttggatgaccatctagtagatgtgcttctggattctgctgcgtcaggatggaacaccgtg
gagagagagggtatctccatctcccaccctgctcggttcatcctcattgggtctggtaac
cccgaggaaggggagctccggccacagctgcttgaccggtttggcatgcacgcgcaggtt
ggtactgtcagggatgctgaactcagggtgaaaattgttgaagagagagctcggttcgac
agggatccaaaggcgttccgtgagtcctacttggaggaacaagacaagctccagcagcag
atttcatctgctcggagtaaccttggtgctgtgcagattgaccatgatcttcgtgttaag
atttctaaagtgtgtgcagagttgaatgttgatggattaagaggggacattgtgactaac
agggctgccaaggcgttggcagcactcaaaggcagggacactgtcactgtagaggacatt
gccactgttatccccaactgcttgaggcatcggcttcggaaggacccacttgaatcaatt
gactcaggattgctcgtggttgagaagttttatgaagtcttcacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334537
Entry
4334537           CDS       T01015                                 
Name
(RefSeq) magnesium-chelatase subunit ChlD, chloroplastic
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4334537
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4334537
SSDB
Motif
Pfam: AAA_lid_2 VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat RXT2_N VWA_3 CCDC53 PAXIP1_C MID_MedPIWI CDC45 Mg_chelatase_C AAA_2
Other DBs
NCBI-GeneID: 4334537
NCBI-ProteinID: XP_015631084
UniProt: Q6ATS0
LinkDB
Position
3:33955203..33961949
AA seq 754 aa
MAMATTALSASLPRLLPPRRRRFPTPSSSSPSAASTSTSRVVRLRAAAASAPSEVLDSTN
GAIPSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMA
RGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFVQIPLGI
TEDRLIGSVDVEASVKSGTTVFQPGLLAEAHRGVLYVDEINLLDEGVSNLLLNVLTEGVN
IVEREGISFRHPCKPLLIATYNPEEGSVREHLLDRIAINLSADLPMSFDDRVAAVDIATQ
FQESSKEVFKMVEEETEVAKTQIILAREYLKDVAISTEQLKYLVMEAIRGGCQGHRAELY
AARVAKCLAAMEGREKVYVDDLKKAVELVILPRSILSDNPQEQQDQQPPPPPPPPPPQDQ
DSQEDQDEDEEEDQEDDDEENEQQDQQIPEEFIFDAEGGIVDEKLLFFAQQAQRRRGKAG
RAKNLIFSSDRGRYIGSMLPKGPIRRLAVDATLRAAAPYQKLRREKDRDKTRKVFVEKTD
MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDFA
EVLLPPSRSIAMARNRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGRIMIVAITDGR
ANVSLKKSTDPEATSDAPRPSSQELKDEILEVAGKIYKAGISLLVIDTENKFVSTGFAKE
IARVAQGKYYYLPNASDAVISAATKTALSDLKSS
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggcgatggccaccaccgcgctctccgcctccctcccgcgcctactcccgcctcgccgc
cgccgcttcccgacgccctcctcctcctccccctccgccgcatccacctccacctcccgc
gtcgtccgcctgcgggccgccgcggcctcggcgccatccgaggtcctcgactccaccaac
ggggccatcccctcggggaagggcggcggcgggcagcagtacgggagggagtatttcccc
ttggccgctgtcgtcgggcaggatgcaattaaaactgctctgctgcttggggcaattgac
cgtgaaattggaggcatcgccatctcagggaagcgtgggacagcaaagacagtgatggct
cgtggcttgcacgctatgcttccacctattgaagtggttgtaggctcgattgcaaatgct
gaccctaactacccagaagaatgggaggagggtttggctaaccaagttcaatatgatgct
gatggtaacttgaagaccgagattatcaaaacaccttttgtgcagatcccgcttggtatc
actgaggataggttaatcggatcagtcgatgttgaagcatctgtgaaatcaggaactact
gtgtttcaacctggccttcttgctgaagctcacagaggcgttctttatgttgatgagata
aatctattggatgagggcgtaagcaatctacttctgaatgtcttgactgagggagtcaat
attgtggaaagagagggcattagctttcgtcatccatgcaaaccacttctaattgctact
tacaacccagaggaaggatctgtacgtgaacacttacttgatcgtattgcaattaattta
agcgctgatctgccaatgagttttgatgatcgtgtggcagctgtggatattgcaacacaa
tttcaagagtccagcaaagaggtttttaaaatggtggaagaagaaactgaggttgcaaaa
acccagataattttggcaagagaatatctgaaagatgttgcaatcagcacagagcagctc
aaatatcttgtcatggaagctatacgcggtggctgtcaggggcaccgggctgagctgtat
gctgctcgagtggcaaaatgtcttgctgctatggaagggcgtgaaaaagtatatgtggat
gaccttaagaaagctgtagagctagttattctacctcgatcaatcctatctgataaccca
caggagcagcaagaccaacaacctcctccacccccaccgccaccccctccacaagatcaa
gattctcaagaagatcaagatgaagacgaggaagaggaccaagaggacgatgatgaagaa
aatgaacagcaggaccagcagatacctgaggagttcatttttgatgctgaaggtggtata
gtagatgagaagctccttttctttgctcagcaagctcaaagacggcgagggaaagctgga
cgagcaaagaatctcatattctcatctgataggggacgatacataggttctatgcttccc
aagggtccaataaggaggttagctgttgatgccacacttcgagcagctgcaccataccag
aaactgaggagagagaaagatcgtgacaagacaagaaaggtttttgttgaaaaaactgac
atgagagccaaaagaatggctcgaaaagcaggcgcactggtcatatttgttgtggatgct
agcggtagcatggctctgaatcgcatgcagaatgcgaaaggtgcagcattaaagttgctt
gcagaaagctacacaagcagagatcaggtttcaatcattccatttcgtggagattttgct
gaggttcttcttccaccttcaagatccatagcaatggcccgcaatcgtcttgagaagcta
ccatgtggtggcggttctcctttagctcacggccttagcacagctgtcagagtgggtttg
aatgctgaaaagagcggtgatgttggacgtatcatgattgttgcaatcaccgatggaaga
gctaatgtgtcactgaagaaatcgactgacccagaagccacttcagatgctccaagacct
tcttctcaagaattaaaggatgagatacttgaggtggctggcaaaatatacaaggctgga
atttcacttcttgttattgataccgagaacaagtttgtatccacaggatttgccaaggaa
attgcaagggtcgcccaaggtaaatactattacctgccgaatgcttcagacgctgttatt
tccgccgccaccaagactgcactctcggacctgaagagttcgtga

DBGET integrated database retrieval system